BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0300 (409 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D17389-4|BAA04212.1| 5112|Drosophila melanogaster ryanodine rece... 29 2.4 D17389-3|BAA41471.1| 5112|Drosophila melanogaster ryanodine rece... 29 2.4 D17389-2|BAA41470.1| 5126|Drosophila melanogaster ryanodine rece... 29 2.4 D17389-1|BAA41469.1| 5126|Drosophila melanogaster ryanodine rece... 29 2.4 AE013599-723|AAM71084.1| 5113|Drosophila melanogaster CG10844-PD... 29 2.4 AE013599-722|AAM71083.1| 5127|Drosophila melanogaster CG10844-PC... 29 2.4 AE013599-721|AAM71082.1| 5113|Drosophila melanogaster CG10844-PB... 29 2.4 AE013599-720|AAF59036.2| 5127|Drosophila melanogaster CG10844-PA... 29 2.4 AE013599-896|AAF58915.1| 725|Drosophila melanogaster CG1863-PA,... 28 5.4 AE013599-895|AAS64887.1| 869|Drosophila melanogaster CG1863-PB,... 28 5.4 >D17389-4|BAA04212.1| 5112|Drosophila melanogaster ryanodine receptor homologue protein. Length = 5112 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4442 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4474 >D17389-3|BAA41471.1| 5112|Drosophila melanogaster ryanodine receptor homologue protein. Length = 5112 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4442 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4474 >D17389-2|BAA41470.1| 5126|Drosophila melanogaster ryanodine receptor homologue protein. Length = 5126 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4456 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4488 >D17389-1|BAA41469.1| 5126|Drosophila melanogaster ryanodine receptor homologue protein. Length = 5126 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4456 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4488 >AE013599-723|AAM71084.1| 5113|Drosophila melanogaster CG10844-PD, isoform D protein. Length = 5113 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4443 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4475 >AE013599-722|AAM71083.1| 5127|Drosophila melanogaster CG10844-PC, isoform C protein. Length = 5127 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4457 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4489 >AE013599-721|AAM71082.1| 5113|Drosophila melanogaster CG10844-PB, isoform B protein. Length = 5113 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4443 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4475 >AE013599-720|AAF59036.2| 5127|Drosophila melanogaster CG10844-PA, isoform A protein. Length = 5127 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 384 FHIFYSIPLYVQFLYFTDIQFLFAFYLNLLSGP 286 F I + I Y + +F ++++F LNL+ GP Sbjct: 4457 FKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGP 4489 >AE013599-896|AAF58915.1| 725|Drosophila melanogaster CG1863-PA, isoform A protein. Length = 725 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 292 RKKIKIKG-EEKLDIRKIEKLNVKGYRIKNMKL 387 R K K+K EEKL + I+++N K + K+MKL Sbjct: 48 RLKDKLKHREEKLKVSIIKQVNAKSFEDKHMKL 80 >AE013599-895|AAS64887.1| 869|Drosophila melanogaster CG1863-PB, isoform B protein. Length = 869 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 292 RKKIKIKG-EEKLDIRKIEKLNVKGYRIKNMKL 387 R K K+K EEKL + I+++N K + K+MKL Sbjct: 48 RLKDKLKHREEKLKVSIIKQVNAKSFEDKHMKL 80 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,712,302 Number of Sequences: 53049 Number of extensions: 212540 Number of successful extensions: 545 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1188481122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -