BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0297 (313 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 25 0.18 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 0.56 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 2.3 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 19 9.2 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 19 9.2 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 25.0 bits (52), Expect = 0.18 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 154 VHGPENDACKPQDAKQSEQLVPVAPAG 234 + PE+D K QD + + +P AP G Sbjct: 233 ISDPEDDDDKDQDMDEGDLPLPAAPGG 259 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.4 bits (48), Expect = 0.56 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 255 CSQLYPDQPNPLQVTTRL 308 C QL PD PN ++ +L Sbjct: 366 CGQLNPDNPNVYEILEKL 383 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 2.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 50 IVNNIAMSCPSG 85 +VN+ + SCPSG Sbjct: 240 LVNSFSCSCPSG 251 Score = 19.8 bits (39), Expect = 6.9 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = -3 Query: 236 KPAGATGTSCSDCLAS*GLQASFSGPXTRAQTQRMTGHC 120 KP G TG++C + + +G + T T HC Sbjct: 50 KP-GFTGSNCQNRINLCDSSPCLNGATCQDHTTHYTCHC 87 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 19.4 bits (38), Expect = 9.2 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 Query: 130 VIRCVCA 150 V+RCVCA Sbjct: 917 VVRCVCA 923 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 19.4 bits (38), Expect = 9.2 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +1 Query: 133 IRCVCARVHGPENDACKPQD 192 + C+C G E A PQ+ Sbjct: 123 LECMCRPCTGVEESAVIPQE 142 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,002 Number of Sequences: 336 Number of extensions: 1285 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5730534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -