BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0295 (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 28 0.076 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.2 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 28.3 bits (60), Expect = 0.076 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 346 KEIINILCKNITLSEDVDMNILAQVTPGFVGADLQALVNKA 468 K I NIL KN+TL++ V + A + + ++ VNKA Sbjct: 73 KHIFNILMKNVTLNDVVFIFCSAPIIITILDIEILGYVNKA 113 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 382 LSEDVDMNILAQVTPGFVGADLQALVNKA 468 L ED+D ++ + GF D + L+ KA Sbjct: 1418 LPEDIDPDLCTHIVYGFAVLDFENLIVKA 1446 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,975 Number of Sequences: 336 Number of extensions: 2669 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -