BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0295 (806 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 60 2e-09 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 59 4e-09 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 57 1e-08 SB_732| Best HMM Match : AAA (HMM E-Value=0) 56 3e-08 SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 54 1e-07 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 53 2e-07 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 52 6e-07 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 51 1e-06 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 43 3e-04 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 42 6e-04 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 38 0.013 SB_3478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 37 0.022 SB_11032| Best HMM Match : AAA (HMM E-Value=3.5) 31 1.1 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 83.0 bits (196), Expect = 3e-16 Identities = 38/76 (50%), Positives = 55/76 (72%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGA 441 P+ALDPALRR GR ++E+ +G+P+ R +I+ CK I LS DVD+ LA++T G+VGA Sbjct: 360 PNALDPALRRPGRFDREVVIGVPSAGQRLDILRAHCKPINLSVDVDLTHLAEITVGYVGA 419 Query: 442 DLQALVNKASTYAVKR 489 DL +L +A+ A+KR Sbjct: 420 DLASLCQQAAFAALKR 435 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/71 (38%), Positives = 45/71 (63%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGA 441 P+A+D AL R GR++ I + P +KAR EI+ + + L+ DVD++++A+ T + GA Sbjct: 708 PEAIDGALLRPGRIDCMIYVPPPDMKARLEILRVHTRFSPLAPDVDLSVIAEGTELYSGA 767 Query: 442 DLQALVNKAST 474 DL+ L + T Sbjct: 768 DLENLCREVYT 778 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/45 (44%), Positives = 30/45 (66%), Gaps = 3/45 (6%) Frame = +2 Query: 68 IRELFERAQAAA---PSVLFIDEIDAVCGNRIHAQKDMEKRMVAQ 193 +R +F +A+ A+ P VLFIDE+DA+C R + + E R+VAQ Sbjct: 293 LRRVFNKARYASRFGPCVLFIDELDALCPKRGSSGNEEENRIVAQ 337 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 79.0 bits (186), Expect = 4e-15 Identities = 40/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLS-EDVDMNILAQVTPGFVG 438 PDALDPALRR GR ++EI +GIP++ R++I+ L KN+ S D D++ LA+ G+VG Sbjct: 405 PDALDPALRRPGRFDREIEIGIPSVTDRRDILVTLLKNVPHSLHDEDISSLAESAHGYVG 464 Query: 439 ADLQALVNKASTYAVKR 489 ADL A +AS YA KR Sbjct: 465 ADLAAACKEASLYAFKR 481 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/42 (50%), Positives = 31/42 (73%) Frame = +2 Query: 65 RIRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRMVA 190 R+RE+F AQ +PS++FIDE+DA+C R Q + E+R+VA Sbjct: 337 RLREIFTEAQNKSPSIVFIDELDALCPRRDKVQNEFERRVVA 378 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/75 (29%), Positives = 41/75 (54%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGA 441 PD +D AL R GR+++ I + +P R+ I+ I +D+ L + T G+ GA Sbjct: 684 PDMIDKALMRPGRVDRLIYVPLPCWDTRRHILEIHLARTPCEGSLDLEDLVERTEGYSGA 743 Query: 442 DLQALVNKASTYAVK 486 ++ A+ +A+ A++ Sbjct: 744 EIAAVCREAALAALQ 758 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/43 (41%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNR-IHAQKDMEKRMVAQ 193 +RE+F +A+A APS++F DE+DA+ G R D+ R++ Q Sbjct: 619 VREVFLKARATAPSIVFFDELDAIAGQRNSTGGSDVNDRVLTQ 661 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 60.5 bits (140), Expect = 2e-09 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = +1 Query: 265 DALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNI--LAQVTPGFVG 438 D LD AL R GR ++ I + +PTL R EI + K +TL +D LA++TPG G Sbjct: 275 DILDNALLRPGRFDRHIAIDLPTLPERMEIFEVHLKKLTLKRSIDQYTKRLAELTPGHSG 334 Query: 439 ADLQALVNKASTYAVK 486 AD+ + N+A+ +A + Sbjct: 335 ADIANICNEAALHAAR 350 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/29 (48%), Positives = 23/29 (79%) Frame = +2 Query: 65 RIRELFERAQAAAPSVLFIDEIDAVCGNR 151 R+R+LF RA+ AP +++IDE+DA+ +R Sbjct: 205 RVRDLFTRARKLAPCIVYIDEVDAIGRSR 233 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 59.3 bits (137), Expect = 4e-09 Identities = 28/81 (34%), Positives = 49/81 (60%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGA 441 PD +DPAL R GRL++ + IP R+E+ L ++ L++D+D++ ++ F GA Sbjct: 813 PDLIDPALLRPGRLDKCVYCPIPDQGDRREVFRALSHDLPLADDIDLDSISDSCHHFTGA 872 Query: 442 DLQALVNKASTYAVKRIFSEI 504 D++AL+ + A+ R S+I Sbjct: 873 DIKALLYNSQLEAIHRTTSKI 893 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRMVAQ 193 +R++F RAQ+A P +LF DE D++ R H + R+V Q Sbjct: 749 VRDMFTRAQSAKPCILFFDEFDSLAPRRGHDSTGVTDRVVNQ 790 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 57.2 bits (132), Expect = 1e-08 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 2/85 (2%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNI--TLSEDVDMNILAQVTPGFV 435 PD LDPAL R GR +++I L P +K R I + K I + E+ +A +TPGF Sbjct: 197 PDVLDPALLRPGRFDRQIHLPAPDIKGRCSIFKVHLKPIKKNVDEEKLARKMAALTPGFT 256 Query: 436 GADLQALVNKASTYAVKRIFSEIHE 510 GAD+ + N+A+ A + + + E Sbjct: 257 GADIANVCNEAALIAARYLAPFVEE 281 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +2 Query: 65 RIRELFERAQAAAPSVLFIDEIDAV 139 R+R+LF +A+ AP ++FIDEIDAV Sbjct: 128 RVRDLFAQARKNAPCIIFIDEIDAV 152 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 56.4 bits (130), Expect = 3e-08 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 4/79 (5%) Frame = +1 Query: 265 DALDPALRRAGRLEQEITLGIPTLKARKEIINI----LCKNITLSEDVDMNILAQVTPGF 432 D +D AL R GRLE ++ +G+P + R +I+ I + +N L++DVD+ LA T F Sbjct: 307 DLIDDALLRPGRLEVQVEIGLPDEEGRVQILKIHTAKMRENKVLADDVDLAELATQTKNF 366 Query: 433 VGADLQALVNKASTYAVKR 489 GA+++ LV A + A+ R Sbjct: 367 TGAEIEGLVRAAQSTAMNR 385 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 56.4 bits (130), Expect = 3e-08 Identities = 32/83 (38%), Positives = 52/83 (62%), Gaps = 1/83 (1%) Frame = +1 Query: 265 DALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGAD 444 D LDPAL R+GRL+++I P +AR I+ I + + +S DV+ + L++ T F GA Sbjct: 243 DILDPALLRSGRLDRKIEFPNPDQEARARILQIHSRKMNVSGDVNFDELSRCTDDFNGAM 302 Query: 445 LQALVNKASTYAVKRIFSEI-HE 510 L+A+ +A A++R +E+ HE Sbjct: 303 LKAVCVEAGMIALRREATEVCHE 325 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNRIHAQK 166 +R+ F A+ AP+++FIDE+DA+ R ++K Sbjct: 175 VRDAFALAKEKAPAIIFIDELDAIGTKRFDSEK 207 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 65 RIRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRMVAQ 193 ++RELF A A AP +LF+DEIDA+ R +A KDME+R+V+Q Sbjct: 757 KVRELFTSAVAQAPCILFLDEIDAITPKRENASKDMERRIVSQ 799 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEII 357 PD+LDPALRRAGR ++EI++GIP AR I+ Sbjct: 824 PDSLDPALRRAGRFDREISMGIPDESARARIV 855 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 53.2 bits (122), Expect = 2e-07 Identities = 29/83 (34%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = +1 Query: 265 DALDPALRRAGRLEQEITLGIPTLKARKEIINILCK--NITLSEDVDMNILAQVTPGFVG 438 DA+DPALRR GR ++E +P AR+ I++I + LS+ ++ LA G+ G Sbjct: 1036 DAIDPALRRPGRFDREFQFALPDRDARRSILSIHTREWEPRLSQRF-ISELADYCVGYCG 1094 Query: 439 ADLQALVNKASTYAVKRIFSEIH 507 AD++AL +A+ A++R + +++ Sbjct: 1095 ADIKALCTEAALCALRRRYPQVY 1117 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 65 RIRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRMVA 190 ++R LF++A A PS++F DEID + R Q + +V+ Sbjct: 970 QLRLLFDQAYAMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVS 1011 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 52.0 bits (119), Expect = 6e-07 Identities = 26/65 (40%), Positives = 43/65 (66%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGA 441 P+A+D AL R GR++ I + P +KAR EI+ + + L+ DVD++++A+ T + GA Sbjct: 241 PEAIDGALLRPGRIDCMIYVPPPDMKARLEILRVHTRFSPLAPDVDLSVIAEGTELYSGA 300 Query: 442 DLQAL 456 DL+ L Sbjct: 301 DLENL 305 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/41 (46%), Positives = 31/41 (75%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRMVA 190 +RELF +A+A AP++LF+DE+D++ G R + ME R++A Sbjct: 95 LRELFLKARATAPAILFLDELDSLAGKRGN-NLGMETRLLA 134 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/47 (46%), Positives = 33/47 (70%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDM 402 P+++D ALRR GR ++E+ +GIP R EI+ I KN+ L +DVD+ Sbjct: 207 PNSVDVALRRFGRFDREVDIGIPDATGRLEILRIHTKNMKLGDDVDL 253 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/75 (34%), Positives = 39/75 (52%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGA 441 PD +DPA+ R GRL+Q I + +P DVD++ +A+VT GF GA Sbjct: 459 PDIIDPAILRPGRLDQLIYIPLPD-----------------DGDVDLDYVAKVTHGFSGA 501 Query: 442 DLQALVNKASTYAVK 486 DL + +A A++ Sbjct: 502 DLTEICQRACKLAIR 516 Score = 37.1 bits (82), Expect = 0.017 Identities = 13/28 (46%), Positives = 24/28 (85%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNR 151 +R++F++A++AAP VLF DE+D++ +R Sbjct: 392 VRDVFDKARSAAPCVLFFDELDSIAKSR 419 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 48.8 bits (111), Expect = 5e-06 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGI-PTLKARKEIINILCKNITLSEDVDMNILAQVTP-GFV 435 PD LDPAL R GR ++ + LG+ A+ ++ L + T S D + A P Sbjct: 958 PDLLDPALLRPGRFDKLLYLGVSEDHHAQLSVLKALTRKFTFSADFRLEEFANKLPLNLT 1017 Query: 436 GADLQALVNKASTYAVKRIFSE 501 GADL A+ + A A++RI E Sbjct: 1018 GADLYAMASDALLQAMRRIIQE 1039 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNR 151 +RE+F RAQAA+P V+F DE+D++ NR Sbjct: 892 VREVFSRAQAASPCVIFFDELDSLAPNR 919 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 42.7 bits (96), Expect = 3e-04 Identities = 15/39 (38%), Positives = 29/39 (74%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRM 184 +++LFE A+ PS++FIDE+D++CG+R + + +R+ Sbjct: 214 VKQLFELARENKPSIIFIDEVDSLCGSRSENESESARRI 252 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/46 (39%), Positives = 30/46 (65%) Frame = +1 Query: 265 DALDPALRRAGRLEQEITLGIPTLKARKEIINILCKNITLSEDVDM 402 D LDPAL R GRL+++I +P + ++ I + + + LSE+VD+ Sbjct: 314 DTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITNKMNLSEEVDL 359 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRM 184 +R++F A+ AP+++FIDEIDA+ R AQ ++ + Sbjct: 246 VRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREV 284 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNR 151 +R LFE A+ APS +F+DEID++C R Sbjct: 331 VRILFEMARFYAPSTIFVDEIDSICSRR 358 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 65 RIRELFERAQAAAPSVLFIDEIDAVCGNRI 154 R+R LF A+ AP ++F+DE+DA+ G+R+ Sbjct: 211 RVRNLFAAAKEHAPCIVFVDELDAIGGSRV 240 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/28 (46%), Positives = 23/28 (82%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNR 151 +R++F+RA+ +AP V+F DE+D++C R Sbjct: 65 VRQVFQRARNSAPCVIFFDELDSLCPRR 92 >SB_3478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/58 (29%), Positives = 33/58 (56%) Frame = +1 Query: 298 RLEQEITLGIPTLKARKEIINILCKNITLSEDVDMNILAQVTPGFVGADLQALVNKAS 471 R++++I +P K ++ I NI + +TL+EDV++ GAD++ +K+S Sbjct: 2 RIDRKIEFPMPDEKTKRRIFNIHTQRMTLAEDVNLEEFIMAKDDLSGADIKVAPSKSS 59 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +1 Query: 262 PDALDPALRRAGRLEQEITLGIPTLK 339 PD LDPAL R GRL++++ G+P L+ Sbjct: 233 PDTLDPALMRPGRLDRKVEFGLPDLE 258 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNR 151 +RELFE A+ ++F DEIDA+ G R Sbjct: 166 VRELFEMARTKKACIVFFDEIDAIGGAR 193 >SB_11032| Best HMM Match : AAA (HMM E-Value=3.5) Length = 111 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +2 Query: 68 IRELFERAQAAAPSVLFIDEIDAVCGNRIHAQKDMEKRM 184 +R +F A+ P+V+F+DEID++ R + + +R+ Sbjct: 8 VRAMFAVARCYLPAVIFMDEIDSLLTQRTDGEHEASRRI 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,424,389 Number of Sequences: 59808 Number of extensions: 334358 Number of successful extensions: 630 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -