BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0294 (728 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF471457-1|AAQ05632.1| 126|Homo sapiens Ig heavy chain variable... 30 7.4 DQ454690-1|ABE66774.1| 97|Homo sapiens immunoglobulin heavy ch... 30 9.8 >AF471457-1|AAQ05632.1| 126|Homo sapiens Ig heavy chain variable region, VH3 family protein. Length = 126 Score = 30.3 bits (65), Expect = 7.4 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -3 Query: 441 NSLSPLDESI--CEKSFGIISAYP*YYHGSDPW 349 NSL D ++ C KSFG S YY+G D W Sbjct: 84 NSLRAEDTAVYYCAKSFGYCSTTSCYYYGMDVW 116 >DQ454690-1|ABE66774.1| 97|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 97 Score = 29.9 bits (64), Expect = 9.8 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 441 NSLSPLDESI--CEKSFGIISAYP*YYHGSDPW 349 NS++P D ++ C + G +S P YY+G D W Sbjct: 55 NSVTPEDTAVYYCAREGGELSLTPYYYYGMDVW 87 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,851,284 Number of Sequences: 237096 Number of extensions: 2038336 Number of successful extensions: 6783 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6783 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8623170556 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -