BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0292 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 27 0.58 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 25 2.4 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 7.2 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 9.5 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 9.5 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 27.1 bits (57), Expect = 0.58 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 362 NFFHFFRDFFCKLTIHFKSEYLISFIKNVLEK 267 +FFHF R K + E ++S++ ++LE+ Sbjct: 14 SFFHFIRKHIPKADLSIVDEIVLSYVISILEE 45 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 204 TVTTHHQVGRKLVCPQGQ*NYRISRRAYGPPDGEWLSSLM 85 +V TH +VG CP ++RR YG P W + +M Sbjct: 154 SVETHGRVG----CPHYMAPEVVARRVYGKPCDVWGAGVM 189 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 46 RQRLGSAPGIADFHERR*P 102 R R G PG A+ H RR P Sbjct: 320 RLRTGPVPGAAERHRRRRP 338 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 186 DGEWLPSPMDFSNAKG*GKP 245 DGEW P +D KG KP Sbjct: 255 DGEWEPPMIDNPEYKGEWKP 274 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 119 AHLMVSGYRRSWKSAMPGAEPSRCLKRH 36 +H M S Y +WK+ E L RH Sbjct: 1701 SHFMNSDYEYNWKNGFGEDEQITILARH 1728 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,294 Number of Sequences: 2352 Number of extensions: 12049 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -