BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0289 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 135 3e-32 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 71 8e-13 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 71 8e-13 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 57 1e-08 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 52 3e-07 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 40 0.001 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 40 0.002 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 39 0.004 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 39 0.004 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 38 0.005 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 36 0.022 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_6602| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 29 2.5 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 29 3.3 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 135 bits (326), Expect = 3e-32 Identities = 72/132 (54%), Positives = 84/132 (63%) Frame = +3 Query: 255 IEIQRKXPNSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIA 434 +E+ R P+SPLYS K+FE L L NL +GVY MGFN PSKIQETALP LLADPP NMIA Sbjct: 88 VEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNMIA 147 Query: 435 QSQSGTGKTAAFVLAMLSRVDSNKNILKYCVLVPHMN*PYKLVKLLQKWQNFVLK*S*SM 614 QSQSGTGKTAAFVL MLSRVD+ K + L P + K+ + + Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKHCPHIKINY 207 Query: 615 QLEGKNFPRGSK 650 + G FPRG K Sbjct: 208 AVRGNQFPRGQK 219 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 70.9 bits (166), Expect = 8e-13 Identities = 34/77 (44%), Positives = 54/77 (70%) Frame = +3 Query: 306 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 485 FE LK LL G++ GF+ PS IQE ++P LA ++++A++++GTGKTAA+++ +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAG--RDILARAKNGTGKTAAYLVPLL 106 Query: 486 SRVDSNKNILKYCVLVP 536 R D+ KN ++ VLVP Sbjct: 107 ERTDTTKNCIQALVLVP 123 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 70.9 bits (166), Expect = 8e-13 Identities = 34/77 (44%), Positives = 54/77 (70%) Frame = +3 Query: 306 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 485 FE LK LL G++ GF+ PS IQE ++P LA ++++A++++GTGKTAA+++ +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAG--RDILARAKNGTGKTAAYLVPLL 106 Query: 486 SRVDSNKNILKYCVLVP 536 R D+ KN ++ VLVP Sbjct: 107 ERTDTTKNCIQALVLVP 123 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 56.8 bits (131), Expect = 1e-08 Identities = 31/77 (40%), Positives = 44/77 (57%) Frame = +3 Query: 306 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 485 F +L L P LL+G+ GF PS IQ A+P L ++IAQ++SGTGKT F + L Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAIP--LGRCGLDLIAQAKSGTGKTCVFSVIAL 72 Query: 486 SRVDSNKNILKYCVLVP 536 V + N ++ +L P Sbjct: 73 ENVITESNCIQIIILTP 89 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 52.8 bits (121), Expect = 2e-07 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 20/89 (22%) Frame = +3 Query: 297 VKTFEALHLKPNLLKGVYAMGFNAPSKIQETAL-PTLLADPP------------------ 419 V++F+ ++LK LL+G+YA GF PS IQ+ A+ P P Sbjct: 62 VESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQEFSPSHVCYNQLNLTKNHYVLS 121 Query: 420 -QNMIAQSQSGTGKTAAFVLAMLSRVDSN 503 +++IAQ+QSGTGKTA F +++L +D+N Sbjct: 122 ARDVIAQAQSGTGKTATFAISILQEIDTN 150 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 52.4 bits (120), Expect = 3e-07 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 3/76 (3%) Frame = +3 Query: 306 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 485 F LKP LL+ + GF PS++Q +P + ++I Q++SG GKTA FVLA L Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG--MDIICQAKSGMGKTAVFVLATL 106 Query: 486 SR---VDSNKNILKYC 524 + VD ++L C Sbjct: 107 QQLEPVDGQVSVLVMC 122 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 52.4 bits (120), Expect = 3e-07 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 3/76 (3%) Frame = +3 Query: 306 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 485 F LKP LL+ + GF PS++Q +P + ++I Q++SG GKTA FVLA L Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG--MDIICQAKSGMGKTAVFVLATL 106 Query: 486 SR---VDSNKNILKYC 524 + VD ++L C Sbjct: 107 QQLEPVDGQVSVLVMC 122 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/60 (41%), Positives = 38/60 (63%) Frame = +3 Query: 357 GFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAMLSRVDSNKNILKYCVLVP 536 GF PS IQ+ A+ +L +++IAQ+QSGTGKTA F +++L +D+ + VL P Sbjct: 16 GFEKPSAIQQRAIKPILKG--RDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSP 73 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 45.2 bits (102), Expect = 5e-05 Identities = 23/63 (36%), Positives = 41/63 (65%) Frame = +3 Query: 306 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 485 FE + L LL V G+ P+ +Q+ A+P + ++++A +Q+G+GKTAAF++ +L Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAIP--IVKGKRDLMACAQTGSGKTAAFLIPIL 934 Query: 486 SRV 494 SR+ Sbjct: 935 SRI 937 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/70 (30%), Positives = 45/70 (64%) Frame = +3 Query: 279 NSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGK 458 N+P+ + +FE +L L V + P+ +Q+ ++P ++A ++++A +Q+G+GK Sbjct: 704 NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAG--RDVMACAQTGSGK 761 Query: 459 TAAFVLAMLS 488 TAAF+L +++ Sbjct: 762 TAAFLLPVMT 771 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/64 (31%), Positives = 41/64 (64%) Frame = +3 Query: 297 VKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVL 476 + +F L L+ + G+ P+ +Q+ ALP ++A ++++A +Q+G+GKTAA++L Sbjct: 478 ITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAG--RDLMACAQTGSGKTAAYML 535 Query: 477 AMLS 488 +L+ Sbjct: 536 PVLT 539 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/78 (32%), Positives = 42/78 (53%) Frame = +3 Query: 303 TFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAM 482 +F L L L+ AMG P++IQ +P +L ++ I +++G+GKTAAF L + Sbjct: 8 SFAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQG--RDCIGCAKTGSGKTAAFALPI 65 Query: 483 LSRVDSNKNILKYCVLVP 536 L ++ + + VL P Sbjct: 66 LQKLCDDPYGIFAVVLTP 83 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/57 (33%), Positives = 35/57 (61%) Frame = +3 Query: 306 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVL 476 F + P L++ + MG P IQE ALP++ + ++++ +S++GTGK+ F+L Sbjct: 162 FSNFGVHPKLVEKLKKMGITKPVPIQEKALPSVFSH--KSLLIKSETGTGKSLVFLL 216 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/65 (27%), Positives = 41/65 (63%) Frame = +3 Query: 291 YSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAF 470 + ++ ++ + ++L+ V +G+ P+ IQ A+P L + +++I +++G+GKTAAF Sbjct: 98 FPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQN--RDIIGVAETGSGKTAAF 155 Query: 471 VLAML 485 + +L Sbjct: 156 AIPLL 160 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/66 (28%), Positives = 40/66 (60%) Frame = +3 Query: 297 VKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVL 476 V +F L L+ ++LK + A+ + P+ IQ +P ++ ++I +Q+G+GKT A++ Sbjct: 377 VYSFAGLGLRDDVLKALDALNIHQPTVIQMVTIPKIIHR--HHVICAAQTGSGKTLAYLA 434 Query: 477 AMLSRV 494 ++ R+ Sbjct: 435 PLVHRL 440 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/52 (38%), Positives = 33/52 (63%) Frame = +3 Query: 339 KGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAMLSRV 494 + V +GF P+ IQ + +P L +++ A + +GTGKTAAF+L +L R+ Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMG--KDVCACAATGTGKTAAFMLPILERL 72 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 36.3 bits (80), Expect = 0.022 Identities = 17/61 (27%), Positives = 37/61 (60%) Frame = +3 Query: 279 NSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGK 458 N+P+ + +FE +L L V + P+ +Q+ ++P ++A ++++A +Q+G+GK Sbjct: 127 NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAG--RDVMACAQTGSGK 184 Query: 459 T 461 T Sbjct: 185 T 185 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 31.9 bits (69), Expect = 0.47 Identities = 21/80 (26%), Positives = 40/80 (50%) Frame = +3 Query: 255 IEIQRKXPNSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIA 434 I++ P P S F ++ + + + P++IQ ALP L+ +++I Sbjct: 505 IKVSGAMPARPCIS---FAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSG--RDIIG 559 Query: 435 QSQSGTGKTAAFVLAMLSRV 494 +++G+GKTAAF+ L + Sbjct: 560 IAKTGSGKTAAFLWPALVHI 579 >SB_6602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 863 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 511 IFLLESTLLNIAKTKAAVFPVPDCDWAI 428 I+ +E+T N +A +PVPD DW I Sbjct: 565 IYDIEATFANFTCPEAFGYPVPDVDWVI 592 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/29 (34%), Positives = 21/29 (72%) Frame = +3 Query: 420 QNMIAQSQSGTGKTAAFVLAMLSRVDSNK 506 +++I Q+++GTGKT +F L ++ ++ K Sbjct: 111 EDVIGQARTGTGKTLSFALPLVEKLQDGK 139 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 29.1 bits (62), Expect = 3.3 Identities = 9/28 (32%), Positives = 23/28 (82%) Frame = +3 Query: 420 QNMIAQSQSGTGKTAAFVLAMLSRVDSN 503 ++++A +++G+GKTAAF++ M ++ ++ Sbjct: 319 KDVVAMARTGSGKTAAFLIPMFEKLQTH 346 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +2 Query: 512 PQVLCLSPTYELAIQTGEVAAKMAKFC 592 P VL L PT ELA Q EVA + K C Sbjct: 133 PIVLVLCPTRELAQQVQEVAYSVGKHC 159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,184,977 Number of Sequences: 59808 Number of extensions: 333155 Number of successful extensions: 733 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -