Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0283
         (728 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019710-1|ABU25222.1|  475|Tribolium castaneum dopa decarboxyla...    31   0.010

>EU019710-1|ABU25222.1|  475|Tribolium castaneum dopa decarboxylase
           protein.
          Length = 475

 Score = 31.1 bits (67), Expect = 0.010
 Identities = 11/36 (30%), Positives = 25/36 (69%), Gaps = 1/36 (2%)
 Frame = -2

Query: 475 RLIPTVKPTHIRPKVPSNG-HV*ERWDRVLLRLEQI 371
           R++PTV+P ++RP +P+      ++W+ V+  +E++
Sbjct: 28  RVLPTVEPGYLRPLIPATAPQKPDKWEDVMADIERV 63


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,187
Number of Sequences: 336
Number of extensions: 3869
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19467635
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)