BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0283 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|... 28 1.6 SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 25 8.4 >SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1402 Score = 27.9 bits (59), Expect = 1.6 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -2 Query: 277 PRGHIVT*KFFPRSFLPKSV--RRPGCGLRFAIFVILLESVRVLIE 146 PR I T K+ P F+PK++ + F +F+++L+S+ + E Sbjct: 86 PRNKIRTAKYTPIDFIPKNIFLQFQNVANLFFLFLVILQSISIFGE 131 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 25.4 bits (53), Expect = 8.4 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 147 SIKTRTDSSKITKMANRRPQPGRRTDFGRNDRGKNFHVTMCPRGSPEARG 296 S+ TR + + + Q ++D+ G+ F PRGSP RG Sbjct: 402 SLTTRRSRRSLYSPSLMQMQQSLKSDY--EGLGRTFDPRFAPRGSPPVRG 449 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,787,127 Number of Sequences: 5004 Number of extensions: 59659 Number of successful extensions: 127 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -