BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0283 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 32 0.016 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 32 0.016 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 26 1.0 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 25 1.8 AJ297932-1|CAC35452.1| 90|Anopheles gambiae gSG1a protein prot... 24 4.2 Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 23 7.3 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 9.7 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 9.7 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 9.7 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 9.7 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 32.3 bits (70), Expect = 0.016 Identities = 12/36 (33%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -2 Query: 475 RLIPTVKPTHIRPKVPSNG-HV*ERWDRVLLRLEQI 371 R++PTV+P ++RP +P E+W+ V+ +E++ Sbjct: 38 RVLPTVQPGYLRPLIPDEAPQQPEKWEEVMADVERV 73 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 32.3 bits (70), Expect = 0.016 Identities = 12/36 (33%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -2 Query: 475 RLIPTVKPTHIRPKVPSNG-HV*ERWDRVLLRLEQI 371 R++PTV+P ++RP +P E+W+ V+ +E++ Sbjct: 69 RVLPTVQPGYLRPLIPDEAPQQPEKWEEVMADVERV 104 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 26.2 bits (55), Expect = 1.0 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -1 Query: 338 RRSLQPEGKGWVTAPPG--LRTATGTHCYVKVFPTVVSTEVRTASRLWSAVRHLCNFTGI 165 R+ EG G ++ G RT G + + + E++ +WS ++HLC GI Sbjct: 83 RKRRATEGNGGKSSTKGKECRTRAGEKGHCTRYQSCKGPELK--DNVWSVLQHLCIVEGI 140 Query: 164 RSG 156 G Sbjct: 141 SVG 143 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 437 GPNMGRFDRGYEPNXMGNHGN 499 GP +GR+ +G +P +GN N Sbjct: 216 GPRLGRYAKGTDPLPLGNPVN 236 >AJ297932-1|CAC35452.1| 90|Anopheles gambiae gSG1a protein protein. Length = 90 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -2 Query: 403 WDRVLLRLEQIK-EVTGKSQR 344 WD +L RLEQ++ +TG S+R Sbjct: 53 WDSLLSRLEQMRHNLTGCSER 73 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 23.4 bits (48), Expect = 7.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 358 GKSQRGLGGASSQREKVG*PLPRASGLPRGHI 263 GKS RGLG A + +G RA+G+ R + Sbjct: 168 GKSSRGLGKAYRYSQTIG-GSRRAAGVRRNRL 198 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 562 RPNEGQRQHNKNSPKXETDSKAK 630 RP+ G R PK DS+ K Sbjct: 477 RPSSGPRYRRTKQPKKRADSEEK 499 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 562 RPNEGQRQHNKNSPKXETDSKAK 630 RP+ G R PK DS+ K Sbjct: 477 RPSSGPRYRRTKQPKKRADSEEK 499 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 297 SPGPPDCHGDTLLRESFSHGRFYRSPYGVPVV 202 SP P D H D + E F H + Y + V Sbjct: 712 SPKPHDSHDDEPMAEIFIHQAIHTIEYVLSTV 743 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 9.7 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 232 LPKSVRRPGCGLRFAIFVILLESVRVLIENDANK 131 LP+ + G G + I E RV +E DANK Sbjct: 346 LPEQLEPHGFGPAYQIRKQQWEGARVPMERDANK 379 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,275 Number of Sequences: 2352 Number of extensions: 15769 Number of successful extensions: 37 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -