BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0281 (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 23 2.9 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 23 2.9 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 23 3.8 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 5.0 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 5.0 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 707 QWRRTATPDFIQILTTSRGLRPLNSEXDALNG 802 QW R +I ++T GL + S +NG Sbjct: 38 QWTREHVAQWINLVTQQHGLPEVPSSRFLMNG 69 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 707 QWRRTATPDFIQILTTSRGLRPLNSEXDALNG 802 QW R +I ++T GL + S +NG Sbjct: 38 QWTREHVAQWINLVTQQHGLPEVPSSRFLMNG 69 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +2 Query: 314 CRSGESPPEPLGR 352 C +GE+P +P+GR Sbjct: 51 CATGEAPCDPVGR 63 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 5.0 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 92 TSPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYS-TVSRS 250 ++PRS SS + S S+ ++ RLL +P+ YS T+ S Sbjct: 152 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNS 205 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 5.0 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 92 TSPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYS-TVSRS 250 ++PRS SS + S S+ ++ RLL +P+ YS T+ S Sbjct: 143 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNS 196 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,513 Number of Sequences: 336 Number of extensions: 4094 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -