BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0278 (629 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.02 |||membrane transporter|Schizosaccharomyces pombe|chr ... 26 5.2 SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schiz... 25 6.8 >SPCC18.02 |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 448 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 406 FGPILCKQVTFFFFSLWPGILPLGQKRVTFFFSVCCGYSF 525 FGP V FS + +PL K + F S+ CG F Sbjct: 251 FGPFWTSFVNSCLFSAFDATIPLELKTLFDFNSLQCGLMF 290 >SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 216 DTRYRERQRLRALY*LETPQPLTSDPRFVSK 308 +T+ + R RALY L QP+ P V K Sbjct: 478 ETKLGDSDRARALYNLAVNQPILETPELVWK 508 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,546,140 Number of Sequences: 5004 Number of extensions: 50305 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -