BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0276 (792 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 27 0.13 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 6.5 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 27.5 bits (58), Expect = 0.13 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 651 QIAKSSLDNSLLKYSAKEYMFPKPPCATVRRHTERAN 761 ++ KS LDN + K + P C T+RR+ AN Sbjct: 562 KVMKSILDNKVEKVVVSNRLVESPCCITMRRYGWTAN 598 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 336 CHQFCRCF*LLQE 374 C ++CR F +LQE Sbjct: 278 CSEYCRVFKMLQE 290 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,236 Number of Sequences: 336 Number of extensions: 2751 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -