SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0276
         (792 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    27   0.13 
EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    22   6.5  

>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 27.5 bits (58), Expect = 0.13
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +3

Query: 651 QIAKSSLDNSLLKYSAKEYMFPKPPCATVRRHTERAN 761
           ++ KS LDN + K      +   P C T+RR+   AN
Sbjct: 562 KVMKSILDNKVEKVVVSNRLVESPCCITMRRYGWTAN 598


>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +3

Query: 336 CHQFCRCF*LLQE 374
           C ++CR F +LQE
Sbjct: 278 CSEYCRVFKMLQE 290


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,236
Number of Sequences: 336
Number of extensions: 2751
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21480183
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -