BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0276 (792 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 25 2.7 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 25 2.7 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 25 2.7 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 4.7 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 4.7 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 2.7 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +3 Query: 660 KSSLDNSLLKYSAKEYMFPKPPCATVRRHTERANAL 767 K SL K SAK F +PP T +T R +AL Sbjct: 26 KPSLAAVTAKSSAKVNQFQQPPEQTTGGNTSRTSAL 61 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 2.7 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +3 Query: 660 KSSLDNSLLKYSAKEYMFPKPPCATVRRHTERANAL 767 K SL K SAK F +PP T +T R +AL Sbjct: 26 KPSLAAVTAKSSAKVNQFQQPPEQTTGGNTSRTSAL 61 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.0 bits (52), Expect = 2.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 563 TSSANKCMLKLAQYAAQLEHYDK 631 T++ +C + + Y EHYDK Sbjct: 18 TATGRRCKQRKSPYTIDFEHYDK 40 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 379 HISCNS*KHLQNWWQHHGEHQLSSGAV 299 ++S + L N H G HQLSSG V Sbjct: 97 NVSTGQNESLANLLLHPGVHQLSSGLV 123 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 379 HISCNS*KHLQNWWQHHGEHQLSSGAV 299 ++S + L N H G HQLSSG V Sbjct: 98 NVSTGQNESLANLLLHPGVHQLSSGLV 124 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,654 Number of Sequences: 2352 Number of extensions: 12631 Number of successful extensions: 44 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -