BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0275 (804 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S57551-1|AAB19934.2| 1073|Homo sapiens guanylate cyclase-coupled... 31 6.4 M73489-1|AAA36655.1| 1073|Homo sapiens heat-stable enterotoxin r... 31 6.4 >S57551-1|AAB19934.2| 1073|Homo sapiens guanylate cyclase-coupled enterotoxin receptor protein. Length = 1073 Score = 30.7 bits (66), Expect = 6.4 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 688 WESDIGLRPTVWYHLRPDNVIP-EPNDWNWVSIHL 789 + D LR W H+ P+N+ P E N+ N VS+ + Sbjct: 457 YRKDYELRQKKWSHIPPENIFPLETNETNHVSLKI 491 >M73489-1|AAA36655.1| 1073|Homo sapiens heat-stable enterotoxin receptor protein. Length = 1073 Score = 30.7 bits (66), Expect = 6.4 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 688 WESDIGLRPTVWYHLRPDNVIP-EPNDWNWVSIHL 789 + D LR W H+ P+N+ P E N+ N VS+ + Sbjct: 457 YRKDYELRQKKWSHIPPENIFPLETNETNHVSLKI 491 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,178,527 Number of Sequences: 237096 Number of extensions: 2615781 Number of successful extensions: 6969 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6969 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9924838204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -