BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0275 (804 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01150.1 68418.m00019 hypothetical protein contains Pfam prof... 30 2.1 At4g23640.1 68417.m03404 potassium transporter / tiny root hair ... 29 3.6 At4g05080.1 68417.m00754 F-box family protein contains Pfam PF00... 28 6.3 At3g13235.1 68416.m01666 ubiquitin family protein contains INTER... 28 6.3 At1g26330.1 68414.m03211 hypothetical protein 28 6.3 At5g64540.1 68418.m08111 hypothetical protein 28 8.3 >At5g01150.1 68418.m00019 hypothetical protein contains Pfam profile PF05056: Protein of unknown function (DUF674) Length = 501 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/78 (24%), Positives = 37/78 (47%) Frame = +2 Query: 464 FVSRKRCLHNRHKKKEKRKVEYIPCAFYLGVDDKDNIFYECDSKYVKVLLKGFQEPIEFV 643 + S+ CL + + E KV + ++ D +F EC ++V++L P+E Sbjct: 244 YKSQSPCLEKKEDEAEPEKV--VTLKAFVRKQDMKILFVECGEEFVELLFSFIAVPLE-- 299 Query: 644 GIAKNSGKAIAVDGIGRV 697 + SG +I++ IG + Sbjct: 300 SAWEISGSSISLGCIGNM 317 >At4g23640.1 68417.m03404 potassium transporter / tiny root hair 1 protein (TRH1) identical to tiny root hair 1 protein [Arabidopsis thaliana] gi|11181958|emb|CAC16137; KUP/HAK/KT Transporter family member, PMID:11500563; identical to cDNA mRNA for tiny root hair 1 protein (trh1) GI:11181957 Length = 775 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -3 Query: 694 SPNXIYSYSFSGILSDTNKFNGLLKAFEQNF-NIFGITFVKYIIFVIYAQIESAGNVF 524 SP +Y +F G L + + AF F I ++ +KY++FV+ A G +F Sbjct: 29 SPLYVYKCTFYGGLRHHQTEDTIFGAFSLIFWTITLLSLIKYMVFVLSADDNGEGGIF 86 >At4g05080.1 68417.m00754 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 391 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = -2 Query: 593 WNHIRKIYYLCHLRPNRKRRECIRLSSFLFFYVDYVNSVFWKQNSVQFISVS 438 WN + K LC +P ++ + LS + + + S +K+N +F+++S Sbjct: 34 WNALSKDRILCKAKPKQQFHQGFMLSDYRLRSMRFNISGTFKENGEEFVNLS 85 >At3g13235.1 68416.m01666 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 414 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +3 Query: 363 NELNSTDKANFVGLKDDDIVQL 428 NE+ ++DK + +G+KDDD++ + Sbjct: 48 NEMGNSDKLSALGVKDDDLLMM 69 >At1g26330.1 68414.m03211 hypothetical protein Length = 1196 Score = 28.3 bits (60), Expect = 6.3 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 10/85 (11%) Frame = +3 Query: 213 GNTSRRQHPDKN----GPYILREGNTIKIDNVRGQASAVDMKRNKVYIASDDGLNE---- 368 GN +++H +N + EGN +D +A +V + +KVYI N+ Sbjct: 561 GNLLQKEHHSENKEPKSTFCSTEGNGFPVDTTPTEACSVKKENHKVYIRKRVSTNQHRIN 620 Query: 369 --LNSTDKANFVGLKDDDIVQLYKP 437 L+S K + +DD ++ P Sbjct: 621 RNLSSESKNSCRNTGEDDSIRNMSP 645 >At5g64540.1 68418.m08111 hypothetical protein Length = 440 Score = 27.9 bits (59), Expect = 8.3 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = +3 Query: 213 GNTSRRQHPDKNGPYILREGNTIKIDNVRGQASAVDMKRNKVYIASDDGL 362 G + Q PD P RE T K A M RNK + SDDGL Sbjct: 349 GLETMTQKPDLASPSAGRETETQKPGLALPSAGLRTMTRNKDWSPSDDGL 398 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,461,576 Number of Sequences: 28952 Number of extensions: 406784 Number of successful extensions: 1212 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -