BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0274 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 3.6 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 3.6 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.3 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 6.3 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.6 bits (46), Expect = 3.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 729 KIGHTPNFGMEKNGN 773 + GHTPN +++ GN Sbjct: 308 RYGHTPNVVLDEEGN 322 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 621 FYA*LYVIK*VSIVFLK*LIKSKKQKWAKFNP 716 F++ LY + + I + + ++K K Q W +F+P Sbjct: 148 FFSALYSLP-ILIFYEEKIVKGKLQCWIEFHP 178 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 348 FNKLY**MICSGLYSGINPLTVDTFRNRTRTG 253 +N LY I L S INP+ + ++ RTG Sbjct: 330 YNILYFCRIMVYLNSAINPILYNLMSSKFRTG 361 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.3 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 Query: 731 DWPYPKFW 754 DW YPK W Sbjct: 1518 DWEYPKCW 1525 Score = 21.8 bits (44), Expect = 6.3 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 Query: 731 DWPYPKFW 754 DW YPK W Sbjct: 1943 DWEYPKCW 1950 Score = 21.8 bits (44), Expect = 6.3 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 Query: 731 DWPYPKFW 754 DW YPK W Sbjct: 2441 DWEYPKCW 2448 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 702 AKFNPSLVGKIGHTPNFGMEKN 767 AKFN S G +P F E+N Sbjct: 109 AKFNESKWQDSGESPGFTTERN 130 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,778 Number of Sequences: 336 Number of extensions: 4116 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -