BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0273 (614 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.6 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 4.7 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.6 bits (46), Expect = 2.7 Identities = 16/59 (27%), Positives = 24/59 (40%) Frame = +3 Query: 42 VIFKA*LRLSKMTMLIQQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSK 218 ++F+ L S T+ Q++ S G G+D E E GD S A S+ Sbjct: 654 LLFETALLSSGFTLDEPQVHASRIYRMIKLGLGIDEEEAMITEDAQGGDAPSADAAESE 712 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 594 HNSLPTYNCVLGEINLELNFNGV 526 HN Y CVLGE+ + G+ Sbjct: 1113 HNCNAYYRCVLGELRKQYCAGGL 1135 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -1 Query: 440 RRCWPKSWSLTIAGHLASRDC 378 R W KS L GH+ R C Sbjct: 231 RTIWSKSKLLIPVGHIPIRQC 251 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,662 Number of Sequences: 336 Number of extensions: 2352 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -