BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0273 (614 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces p... 27 1.6 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 27 2.2 SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ... 26 3.8 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 26 5.0 SPBC1A4.09 |||pseudouridine synthase|Schizosaccharomyces pombe|c... 25 6.6 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 8.7 >SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 275 Score = 27.5 bits (58), Expect = 1.6 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 279 RGPAPRHSGNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPHH 136 R P+P H +R P E S RS +PR+R++ P RSP + Sbjct: 116 RSPSP-HEARSRSPYNDERSD---RRSMSPRYRSRSRSPDGRSRSPDY 159 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 27.1 bits (57), Expect = 2.2 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -3 Query: 306 RXQGHQDHHRGPAPRHSGNTRRPKPTELSACCRERSETPRHRNKPS 169 R + Q++ P P SG +P P E ++ S P KPS Sbjct: 231 RKEKSQENKPKPTPFGSGGPSKPTPFESHGPAKQISVQPSEHPKPS 276 >SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 26.2 bits (55), Expect = 3.8 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -3 Query: 357 GVAGLAAPPVTLRAVQSRXQGHQDHHRGPAPRHSGNTRRPKPTELS 220 GV + P T + QS G R P+PR R P P+ LS Sbjct: 324 GVGSVPLPAPT--SSQSLRLGSLHRSRSPSPRSGRPRRSPSPSHLS 367 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 25.8 bits (54), Expect = 5.0 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -3 Query: 321 RAVQSRXQGHQDHHRGPAPRHSGNTRRPKPTELSACCRERSETPRH 184 R + +G HH+G + G PKP + S + E P+H Sbjct: 144 RRKHGKCKGKGKHHKGKHAKGKGKKSHPKPEDDSVFFDD--ERPKH 187 >SPBC1A4.09 |||pseudouridine synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 680 Score = 25.4 bits (53), Expect = 6.6 Identities = 14/68 (20%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = -3 Query: 441 SALLAKELELDHSRALSKSRLSSWLGVX--GVAGLAAPPVTLRAVQSRXQGHQDHHRGPA 268 + + KE ++ +L + ++ G+ G + + + +R +QS +G D P Sbjct: 339 NVITPKEKVVEALNSLKEHGFINYFGLQRFGTSSVGTHTIGVRLLQSDWKGAVDLILSPR 398 Query: 267 PRHSGNTR 244 P H+G+ + Sbjct: 399 PEHTGSVK 406 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 25.0 bits (52), Expect = 8.7 Identities = 14/70 (20%), Positives = 25/70 (35%) Frame = -3 Query: 339 APPVTLRAVQSRXQGHQDHHRGPAPRHSGNTRRPKPTELSACCRERSETPRHRNKPSRPV 160 AP +V + H +P + ++ ++ R +S+ RH S Sbjct: 1241 APSSEAPSVSTPRSSVPSPHSNASPSPTSSSMASAAPARTSVSRSKSKAERHETSTSSRK 1300 Query: 159 WSRRSPHHFH 130 S+ HH H Sbjct: 1301 SSKSGEHHHH 1310 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,123,599 Number of Sequences: 5004 Number of extensions: 34431 Number of successful extensions: 103 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -