BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0271 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 4.9 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.4 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.4 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.4 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.4 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.4 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.4 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 6.4 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 6.4 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.8 bits (49), Expect = 4.9 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 248 IKDSRSLISSSARP*MMRFLRSCLYRNKHVPDSAHVSRHLLPLATTTVILVWVXSA 415 IK + ++SSSA + FL NKHV ++ V ++ + ++ V + SA Sbjct: 525 IKYALKMLSSSAETIIFMFLGVATVNNKHVWNTWFVLLTIIFCSVYRILGVLILSA 580 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 324 LYRHDLKNLIIQGRAEE 274 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 324 LYRHDLKNLIIQGRAEE 274 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 324 LYRHDLKNLIIQGRAEE 274 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 324 LYRHDLKNLIIQGRAEE 274 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 324 LYRHDLKNLIIQGRAEE 274 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 324 LYRHDLKNLIIQGRAEE 274 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 253 RFEIIDFFLGPSLNDEVLKIMPV 321 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 324 LYRHDLKNLIIQGRAEE 274 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,609 Number of Sequences: 2352 Number of extensions: 12554 Number of successful extensions: 31 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -