BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0270 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 95 2e-21 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 7.6 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 95.1 bits (226), Expect = 2e-21 Identities = 47/97 (48%), Positives = 57/97 (58%) Frame = +1 Query: 256 SSIKADKDKFQVNLDVQHFSPEEISVKTADGYIVVXXXXXXXXXXXXYISRQFVRRYALP 435 S++ KDKFQ+NLDVQ FSPEEISVK D ++V Y+SR FVRRY LP Sbjct: 6 SAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLP 65 Query: 436 EGAAPETVESRLSSDGVLTITAPRRYPTPSRESERCP 546 +G + S LSSDG+LTIT PR+ E P Sbjct: 66 KGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIP 102 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 189 QATAASMSFGVSANPKS*STRRLGQWL*RTRG 94 ++ A S G A PK+ + +G W TRG Sbjct: 139 RSMAGFRSLGSGAPPKAQGGKHVGNWEQHTRG 170 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 794,919 Number of Sequences: 2352 Number of extensions: 16769 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -