BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0269 (396 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 25 0.31 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 0.55 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 0.55 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 2.9 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 20 9.0 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 20 9.0 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 25.0 bits (52), Expect = 0.31 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 72 FMNL*TTRFPTAGHLSQCTPMIXVAPFSLCRERGETRWL 188 +++ T F T+ + C + V PFS E E RWL Sbjct: 75 YLHTATNYFVTSLAFADCLVGLVVMPFSAIYEVLENRWL 113 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 0.55 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 237 GHAVGDIPGVRFKVVKVANVSLL 169 GH V D+PGVR +V++ + LL Sbjct: 69 GHPVNDVPGVR-RVLRNGTLVLL 90 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 0.55 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 237 GHAVGDIPGVRFKVVKVANVSLL 169 GH V D+PGVR +V++ + LL Sbjct: 69 GHPVNDVPGVR-RVLRNGTLVLL 90 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 1.3 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 237 GHAVGDIPGVR 205 G AVGD+PG+R Sbjct: 42 GSAVGDVPGLR 52 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 2.9 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 377 PNSAIRKCV 351 PNSA+RKC+ Sbjct: 584 PNSAVRKCM 592 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 20.2 bits (40), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 291 ATVTGDECGHFLSVLNE 341 AT+ D+CG ++LNE Sbjct: 298 ATILVDDCGCNSTMLNE 314 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 20.2 bits (40), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 291 ATVTGDECGHFLSVLNE 341 AT+ D+CG ++LNE Sbjct: 298 ATILVDDCGCNSTMLNE 314 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,958 Number of Sequences: 438 Number of extensions: 1600 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -