BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0267 (799 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) 30 2.5 SB_55648| Best HMM Match : NCD3G (HMM E-Value=5.3) 30 2.5 >SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) Length = 1127 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/56 (32%), Positives = 21/56 (37%) Frame = +2 Query: 278 CRPKGGR*ETQKKRGLGRRDVNLFRRTLRHQVSSRYSGFSVDEKMGALKINLFSKW 445 CRP G E Q+ RG+ RR LF L + MG F KW Sbjct: 183 CRPCGANREGQRMRGVERRARKLFAPVLSDIAADVQEYIEATHSMGGAIGYRFKKW 238 >SB_55648| Best HMM Match : NCD3G (HMM E-Value=5.3) Length = 446 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/56 (32%), Positives = 21/56 (37%) Frame = +2 Query: 278 CRPKGGR*ETQKKRGLGRRDVNLFRRTLRHQVSSRYSGFSVDEKMGALKINLFSKW 445 CRP G E Q+ RG+ RR LF L + MG F KW Sbjct: 183 CRPCGANREGQRMRGVERRARKLFAPVLSDIAADVQEYIEATHSMGGAIGYRFKKW 238 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,724,266 Number of Sequences: 59808 Number of extensions: 370887 Number of successful extensions: 607 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -