Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0267
         (799 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    24   1.4  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    22   7.6  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 10/30 (33%), Positives = 13/30 (43%)
 Frame = +1

Query: 265 PLWALQA*RGAVRDPEKKGAWEARCKFIQE 354
           P+W +      V        W  RCKF+QE
Sbjct: 906 PVWQVTLNARLVELSLGSNPWSCRCKFLQE 935


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -2

Query: 306 VSYRPPLGLQRPQ 268
           +S+  PLGL+RPQ
Sbjct: 470 MSFGEPLGLRRPQ 482


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 188,090
Number of Sequences: 438
Number of extensions: 3770
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25246416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)