BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0267 (799 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 30 2.0 At5g25350.1 68418.m03007 F-box family protein contains Pfam PF00... 29 4.7 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 721 YVIFKIKPKHGKCEYY 768 YV+F++ PKH KCE + Sbjct: 9 YVVFELSPKHSKCELF 24 >At5g25350.1 68418.m03007 F-box family protein contains Pfam PF00646: F-box domain and Pfam PF00560: Leucine Rich Repeat (6 copies); similar to F-box protein FBL6 (GI:4432860) [Homo sapiens] Length = 623 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 68 SCFSMNYSDIDLFFLKFHGARLLIN*PNSLK-QIVTLQHCQNL 193 +C+S+N DI + HG + L + PN L Q++++ C ++ Sbjct: 536 NCYSVNDLDISNTLVSDHGIKALASSPNHLNLQVLSIGGCSSI 578 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,664,453 Number of Sequences: 28952 Number of extensions: 269917 Number of successful extensions: 440 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -