BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0266 (877 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 36 0.033 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 34 0.13 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 33 0.30 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 33 0.40 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_36033| Best HMM Match : ATP-synt_B (HMM E-Value=1) 32 0.70 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 32 0.70 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 31 0.92 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 31 0.92 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 31 0.92 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 31 0.92 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 31 0.92 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 31 0.92 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 31 0.92 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 31 0.92 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 31 0.92 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 31 0.92 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 31 0.92 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_5636| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 31 1.2 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 31 1.2 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 31 1.2 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 31 1.2 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 31 1.2 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 31 1.2 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 31 1.2 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 31 1.2 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 31 1.2 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 31 1.2 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 31 1.2 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 31 1.6 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 30 2.1 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) 30 2.1 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 30 2.1 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 30 2.1 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) 30 2.1 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 30 2.1 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 30 2.1 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1381| Best HMM Match : TP2 (HMM E-Value=5.2) 30 2.1 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_24705| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 30 2.8 SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) 29 3.7 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 29 3.7 SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) 29 3.7 SB_1240| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 29 4.9 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 29 4.9 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_40170| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_4873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_4841| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 29 6.5 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 29 6.5 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 29 6.5 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 29 6.5 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 29 6.5 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 29 6.5 SB_41525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_38022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35116| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 29 6.5 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 29 6.5 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 29 6.5 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_31194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 29 6.5 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 29 6.5 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 29 6.5 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 29 6.5 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 29 6.5 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 29 6.5 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 29 6.5 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_16406| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 29 6.5 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 29 6.5 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) 29 6.5 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 29 6.5 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 29 6.5 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_2493| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_1489| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.77) 29 6.5 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 29 6.5 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 29 6.5 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_58381| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 29 6.5 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_53203| Best HMM Match : UCR_TM (HMM E-Value=5.1) 29 6.5 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 29 6.5 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 29 6.5 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 29 6.5 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 29 6.5 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46741| Best HMM Match : UCR_TM (HMM E-Value=5.1) 29 6.5 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 29 6.5 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 29 6.5 SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_45316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 29 6.5 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40405| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 29 6.5 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_37721| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 29 6.5 SB_35731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 29 6.5 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_33484| Best HMM Match : UCR_TM (HMM E-Value=5.1) 29 6.5 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 29 LELVDPPGCRNSARGGSV 82 LELVDPPGCRNS GG V Sbjct: 100 LELVDPPGCRNSITGGPV 117 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 29 LELVDPPGCRNSARGGSVPS 88 LELVDPPGCRNS +VP+ Sbjct: 13 LELVDPPGCRNSIEDFNVPA 32 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 29 LELVDPPGCRNSARGGSV 82 LELVDPPGCRNS G V Sbjct: 30 LELVDPPGCRNSIDGNGV 47 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -2 Query: 105 RXXRRLDGTEPPRAEFLQPGGSTSSR 28 R R +D P EFLQPGGSTSSR Sbjct: 42 RETRLIDEVAPWAIEFLQPGGSTSSR 67 >SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = -2 Query: 120 EIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 E +++ LD E EFLQPGGSTSSR Sbjct: 20 EYIDRGVHIALDAQESTGIEFLQPGGSTSSR 50 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 81 TEPPRAEFLQPGGSTSSR 28 T+ P+ EFLQPGGSTSSR Sbjct: 3 TKVPKIEFLQPGGSTSSR 20 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 93 RLDGTEPPRAEFLQPGGSTSSR 28 ++D T R EFLQPGGSTSSR Sbjct: 2 QIDETGESRIEFLQPGGSTSSR 23 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 29 LELVDPPGCRNSARGGSV 82 LELVDPPGCRNS + SV Sbjct: 13 LELVDPPGCRNSIQARSV 30 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 138 RHQIWTEIVEKRXXRRLDGT-EPPRAEFLQPGGSTSSR 28 RH +++ + + G PP EFLQPGGSTSSR Sbjct: 52 RHMYVAKVLVGKYTQGRQGLLNPPCIEFLQPGGSTSSR 89 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 PR EFLQPGGSTSSR Sbjct: 40 PRIEFLQPGGSTSSR 54 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 29 LELVDPPGCRNSARG 73 LELVDPPGCRNS G Sbjct: 13 LELVDPPGCRNSIEG 27 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 Query: 29 LELVDPPGCRNSARGGSVPS 88 LELVDPPGCRNS G P+ Sbjct: 13 LELVDPPGCRNSIVLGVAPN 32 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS R Sbjct: 13 LELVDPPGCRNSIR 26 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 29 LELVDPPGCRNSARGG 76 LELVDPPGCRNS + G Sbjct: 13 LELVDPPGCRNSIKYG 28 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS R Sbjct: 13 LELVDPPGCRNSIR 26 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 29 LELVDPPGCRNSARG 73 LELVDPPGCRNS G Sbjct: 89 LELVDPPGCRNSIAG 103 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 LDG + EFLQPGGSTSSR Sbjct: 12 LDGIDKLDIEFLQPGGSTSSR 32 >SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1153 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -2 Query: 180 WTQILISNDCRMISRHQIWTEIVEKRXXRRLDGTEPPRA--EFLQPGGSTSSR 28 + +IL SN + + + W + ++ RR P EFLQPGGSTSSR Sbjct: 326 YKRILRSNGKKCVRKVTSWKQTLKTAVDRRY-AINPSSIVIEFLQPGGSTSSR 377 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 29 LELVDPPGCRNSARG 73 LELVDPPGCRNS G Sbjct: 13 LELVDPPGCRNSMIG 27 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +2 Query: 29 LELVDPPGCRNSARGG 76 LELVDPPGCRNS G Sbjct: 13 LELVDPPGCRNSMSQG 28 >SB_36033| Best HMM Match : ATP-synt_B (HMM E-Value=1) Length = 550 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = -2 Query: 678 CWVXLSGFVSIGPFSVVXFPIDVSFXXIFTLTAMAVTFSREARITISIFIAS 523 CW+ + F SIGP +V+ + + F ++ L + R A I I+++I S Sbjct: 239 CWLAMVLFASIGPLTVLGYFLFHGF-LLYRLVLFTLWLRRRAAIQITVWIRS 289 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.9 bits (69), Expect = 0.70 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 29 LELVDPPGCRNSARGGSVPSXXXXXXFS 112 LELVDPPGCRNS S +S Sbjct: 13 LELVDPPGCRNSMENARTSSPGFQGAYS 40 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P+ EFLQPGGSTSSR Sbjct: 50 PKIEFLQPGGSTSSR 64 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = -2 Query: 120 EIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 +I+ R+D P EFLQPGGSTSSR Sbjct: 40 QILRVANISRIDALRP-NIEFLQPGGSTSSR 69 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = -2 Query: 180 WTQILISNDCRMISRHQIWTEIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 +T LIS + R++ H ++ R T EFLQPGGSTSSR Sbjct: 4 FTDTLISANIRVLETHYR----SQRPRIRESPSTLGQNIEFLQPGGSTSSR 50 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 12 VDGIDKLDIEFLQPGGSTSSR 32 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 30 VDGIDKLDIEFLQPGGSTSSR 50 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 55 VDGIDKLDIEFLQPGGSTSSR 75 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS + Sbjct: 13 LELVDPPGCRNSIK 26 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 27 VDGIDKLDIEFLQPGGSTSSR 47 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS + Sbjct: 13 LELVDPPGCRNSMK 26 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.5 bits (68), Expect = 0.92 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +2 Query: 29 LELVDPPGCRNSARGG 76 LELVDPPGCRNS G Sbjct: 13 LELVDPPGCRNSMHIG 28 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 31.5 bits (68), Expect = 0.92 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +1 Query: 505 PTYSPERRDKD-RDSY-SRFSAERDSHRSEGEYXXERYVDRKXYDGKWADGNETRKXHPT 678 P Y RR + RD Y +R D RS RY DR+ Y G +DG+ T + T Sbjct: 1146 PDYDSHRRSSNPRDYYETRRDYPDDMDRSRSRDYDYRY-DRRDYSGYHSDGSYTDPYYHT 1204 Query: 679 RRKG 690 + +G Sbjct: 1205 QDRG 1208 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 31.5 bits (68), Expect = 0.92 Identities = 16/21 (76%), Positives = 16/21 (76%), Gaps = 3/21 (14%) Frame = -2 Query: 81 TEPPRA---EFLQPGGSTSSR 28 TEPP EFLQPGGSTSSR Sbjct: 97 TEPPTISDIEFLQPGGSTSSR 117 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS + Sbjct: 13 LELVDPPGCRNSIK 26 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS + Sbjct: 13 LELVDPPGCRNSMK 26 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS + Sbjct: 68 LELVDPPGCRNSMK 81 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 26 VDGIDKLDIEFLQPGGSTSSR 46 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 30 VDGIDKLDIEFLQPGGSTSSR 50 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS + Sbjct: 13 LELVDPPGCRNSIK 26 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 27 VDGIDKLDIEFLQPGGSTSSR 47 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 29 LELVDPPGCRNSARGGSV 82 LELVDPPGCRNS SV Sbjct: 50 LELVDPPGCRNSINIESV 67 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 31.5 bits (68), Expect = 0.92 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 96 RRLDGTEPPRAEFLQPGGSTSSR 28 R +D T P EFLQPGGSTSSR Sbjct: 64 RCIDHTRPT-IEFLQPGGSTSSR 85 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 14 VDGIDKLDIEFLQPGGSTSSR 34 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 26 VDGIDKLDIEFLQPGGSTSSR 46 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 63 VDGIDKLDIEFLQPGGSTSSR 83 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_5636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 96 RRLDGTEPPRAEFLQPGGSTSSR 28 R L G EFLQPGGSTSSR Sbjct: 12 RHLTGHAKNNIEFLQPGGSTSSR 34 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 31.5 bits (68), Expect = 0.92 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 LELVDPPGCRNSAR 70 LELVDPPGCRNS + Sbjct: 13 LELVDPPGCRNSMK 26 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTSSR Sbjct: 25 VDGIDKLDIEFLQPGGSTSSR 45 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 109 PNIEFLQPGGSTSSR 123 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 9 PNIEFLQPGGSTSSR 23 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 87 DGTEPPRAEFLQPGGSTSSR 28 D T+P EFLQPGGSTSSR Sbjct: 19 DATKPS-IEFLQPGGSTSSR 37 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 33 LELVDPPGCRNS 44 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 89 LELVDPPGCRNS 100 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 657 LELVDPPGCRNS 668 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 30 LELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 70 LELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 28 PEIEFLQPGGSTSSR 42 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 3 PEIEFLQPGGSTSSR 17 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 96 RRLDGTEPPRAEFLQPGGSTSSR 28 R LD T R EFLQPGGSTSSR Sbjct: 11 RELD-TLLERIEFLQPGGSTSSR 32 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 33 PNIEFLQPGGSTSSR 47 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 100 LELVDPPGCRNS 111 >SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 26 PEIEFLQPGGSTSSR 40 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 29 LELVDPPGCRNS 64 LELVDPPGCRNS Sbjct: 76 LELVDPPGCRNS 87 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 23 PMIEFLQPGGSTSSR 37 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 146 PAIEFLQPGGSTSSR 160 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 225 PSEIEFLQPGGSTSSR 240 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 78 EPPRAEFLQPGGSTSSR 28 +P EFLQPGGSTSSR Sbjct: 37 DPRTIEFLQPGGSTSSR 53 >SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 129 IWTEIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 +W EI ++ R E EFLQPGGSTSSR Sbjct: 14 VWREIRNEQCDRT--EIEINSIEFLQPGGSTSSR 45 >SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 78 EPPRAEFLQPGGSTSSR 28 +P EFLQPGGSTSSR Sbjct: 40 KPTTIEFLQPGGSTSSR 56 >SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 3 PTHIEFLQPGGSTSSR 18 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 13 PTIEFLQPGGSTSSR 27 >SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 14 PKHIEFLQPGGSTSSR 29 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 50 RIEFLQPGGSTSSR 63 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 78 EPPRAEFLQPGGSTSSR 28 E + EFLQPGGSTSSR Sbjct: 37 EQQKIEFLQPGGSTSSR 53 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 16 RIEFLQPGGSTSSR 29 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 19 RIEFLQPGGSTSSR 32 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 113 PGIEFLQPGGSTSSR 127 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 428 PRHIEFLQPGGSTSSR 443 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 5 RIEFLQPGGSTSSR 18 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EF+QPGGSTSSR Sbjct: 25 VDGIDKLDIEFVQPGGSTSSR 45 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EF+QPGGSTSSR Sbjct: 12 VDGIDKLDIEFVQPGGSTSSR 32 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 40 PDIEFLQPGGSTSSR 54 >SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) Length = 213 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 139 RIEFLQPGGSTSSR 152 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGSTS+R Sbjct: 25 VDGIDKLDIEFLQPGGSTSAR 45 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 16 RIEFLQPGGSTSSR 29 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 228 RIEFLQPGGSTSSR 241 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 12 PPIEFLQPGGSTSSR 26 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 2 RIEFLQPGGSTSSR 15 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 7 PYIEFLQPGGSTSSR 21 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 64 RIEFLQPGGSTSSR 77 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 81 TEPPRAEFLQPGGSTSSR 28 T+ EFLQPGGSTSSR Sbjct: 251 TDQDEIEFLQPGGSTSSR 268 >SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) Length = 91 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 2 PYIEFLQPGGSTSSR 16 >SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) Length = 141 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 17 RIEFLQPGGSTSSR 30 >SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 7 RIEFLQPGGSTSSR 20 >SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 24 RIEFLQPGGSTSSR 37 >SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 78 RIEFLQPGGSTSSR 91 >SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 93 RLDGTEPPRA--EFLQPGGSTSSR 28 R GT P EFLQPGGSTSSR Sbjct: 27 RSTGTRAPDGSIEFLQPGGSTSSR 50 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 24 PPIEFLQPGGSTSSR 38 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EFLQPGGST+SR Sbjct: 25 VDGIDKLDIEFLQPGGSTTSR 45 >SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 64 RIEFLQPGGSTSSR 77 >SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 19 PDIEFLQPGGSTSSR 33 >SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 26 RIEFLQPGGSTSSR 39 >SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 12 RIEFLQPGGSTSSR 25 >SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 93 RLDGTEPPRAEFLQPGGSTSSR 28 R+D EFLQPGGSTSSR Sbjct: 3 RIDSKIRSSIEFLQPGGSTSSR 24 >SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 15 RIEFLQPGGSTSSR 28 >SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 44 RIEFLQPGGSTSSR 57 >SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 4 RIEFLQPGGSTSSR 17 >SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 68 RIEFLQPGGSTSSR 81 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 25 RIEFLQPGGSTSSR 38 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 81 TEPPRAEFLQPGGSTSSR 28 T + EFLQPGGSTSSR Sbjct: 25 TRSAKIEFLQPGGSTSSR 42 >SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 R EFLQPGGSTSSR Sbjct: 17 RIEFLQPGGSTSSR 30 >SB_1381| Best HMM Match : TP2 (HMM E-Value=5.2) Length = 428 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 7/33 (21%) Frame = -2 Query: 105 RXXRRLDGTE-PPRA------EFLQPGGSTSSR 28 R ++ D T+ PP+A EFLQPGGSTSSR Sbjct: 125 RRKKKQDTTDSPPKAGQEMEIEFLQPGGSTSSR 157 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 32 PDIEFLQPGGSTSSR 46 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 10 PGAIEFLQPGGSTSSR 25 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 22 PCIEFLQPGGSTSSR 36 >SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 31 PLHIEFLQPGGSTSSR 46 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 20 PIIEFLQPGGSTSSR 34 >SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 81 TEPPRAEFLQPGGSTSSR 28 T P EFLQPGGSTSSR Sbjct: 3 TGPIIIEFLQPGGSTSSR 20 >SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 17 PIIEFLQPGGSTSSR 31 >SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 15 PWIEFLQPGGSTSSR 29 >SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 96 RRLDGTEPPRAEFLQPGGSTSSR 28 R D + EFLQPGGSTSSR Sbjct: 11 RNFDFAKIKSIEFLQPGGSTSSR 33 >SB_24705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 L T EFLQPGGSTSSR Sbjct: 53 LHATRKRSIEFLQPGGSTSSR 73 >SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) Length = 571 Score = 29.9 bits (64), Expect = 2.8 Identities = 21/50 (42%), Positives = 27/50 (54%) Frame = -2 Query: 177 TQILISNDCRMISRHQIWTEIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 TQ +I + +I Q +++ RLD P EFLQPGGSTSSR Sbjct: 417 TQFVIDSTQFVIDSTQF---VIDSTHFVRLD---PICIEFLQPGGSTSSR 460 >SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 9 PDLIEFLQPGGSTSSR 24 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/20 (75%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -2 Query: 84 GTEPPRA-EFLQPGGSTSSR 28 GT R EFLQPGGSTSSR Sbjct: 17 GTREERMIEFLQPGGSTSSR 36 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 3 PVDIEFLQPGGSTSSR 18 >SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) Length = 426 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +1 Query: 526 RDKDRDSYSRFSAERDSHRSEGEYXXERYVDRKXYD-GKWADGNETRKXHPTRRKGPQKN 702 RD+DRD Y R RDS R Y +R R+ D ++ D R+ R GP Sbjct: 124 RDRDRDRYDRDRGRRDSDRD--RYDRDR--GRRDGDRDRYRDDRRGRRDRFRRSPGPCTP 179 Query: 703 LKSNPII 723 + P + Sbjct: 180 VVKTPAV 186 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 10 PVYIEFLQPGGSTSSR 25 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 84 GTEPPRAEFLQPGGSTSSR 28 G++P EFLQPGGSTSSR Sbjct: 38 GSQP--IEFLQPGGSTSSR 54 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 87 DGTEPPRAEFLQPGGSTSSR 28 D T EFLQPGGSTSSR Sbjct: 36 DPTLRANIEFLQPGGSTSSR 55 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 34 PVLIEFLQPGGSTSSR 49 >SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 84 GTEPPRAEFLQPGGSTSSR 28 G P EFLQPGGSTSSR Sbjct: 21 GGLPVVIEFLQPGGSTSSR 39 >SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 8 PQCIEFLQPGGSTSSR 23 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 32 ELVDPPGCRNS 64 ELVDPPGCRNS Sbjct: 319 ELVDPPGCRNS 329 >SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +1 Query: 526 RDKDRDSYSRFSAERDSHRSEGEYXXERYVDRKXYD-GKWADGNETRKXHPTRRKGPQKN 702 RD+DRD Y R RDS R Y +R R+ D ++ D R+ R GP Sbjct: 124 RDRDRDRYDRDRGRRDSDRD--RYDRDR--GRRDGDRDRYRDDRRGRRDRFRRSPGPCTP 179 Query: 703 LKSNPII 723 + P + Sbjct: 180 VVKTPAV 186 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +1 Query: 526 RDKDRDSYSRFSAERDSHRSEGEYXXERYVDRKXYD-GKWADGNETRKXHPTRRKGPQKN 702 RD+DRD Y R RDS R Y +R R+ D ++ D R+ R GP Sbjct: 395 RDRDRDRYDRDRGRRDSDRD--RYDRDR--GRRDGDRDRYRDDRRGRRDRFRRSPGPCTP 450 Query: 703 LKSNPII 723 + P + Sbjct: 451 VVKTPAV 457 >SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = -2 Query: 183 PWTQILISNDCRMISRHQIWTEIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 P + +D ++++R + + + + EFLQPGGSTSSR Sbjct: 15 PEHSTITRSDSQLLNRDHTDADTLSQGDSSLETSASGAKIEFLQPGGSTSSR 66 >SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) Length = 189 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 63 PMGIEFLQPGGSTSSR 78 >SB_1240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 2 PYTIEFLQPGGSTSSR 17 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 L G EFLQPGGSTSSR Sbjct: 28 LPGLGLSNIEFLQPGGSTSSR 48 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 93 KIEFLQPGGSTSSR 106 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 123 TEIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 T ++ RR EFLQPGGSTSSR Sbjct: 3 TRLLSGILSRRASKAASTVIEFLQPGGSTSSR 34 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 69 KIEFLQPGGSTSSR 82 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 44 KIEFLQPGGSTSSR 57 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 29 KIEFLQPGGSTSSR 42 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -2 Query: 147 MISRHQIWTEI--VEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 +IS + + E+ V+K L + EFLQPGGSTSSR Sbjct: 8 LISANILGLEVKQVKKLALEYLGKNQFDTIEFLQPGGSTSSR 49 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 80 KIEFLQPGGSTSSR 93 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 25 KIEFLQPGGSTSSR 38 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 135 HQIWTEI--VEKRXXRRLDGTEPPR--AEFLQPGGSTSSR 28 H W E+ + R + E R EFLQPGGSTSSR Sbjct: 32 HTTWNELPCINSRYAGLRNAPEVFRFGIEFLQPGGSTSSR 71 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EF++PGGSTSSR Sbjct: 25 VDGIDKLDIEFVEPGGSTSSR 45 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 9 KIEFLQPGGSTSSR 22 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 17 KIEFLQPGGSTSSR 30 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 30 PYYIEFLQPGGSTSSR 45 >SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 50 KIEFLQPGGSTSSR 63 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 90 LDGTEPPRAEFLQPGGSTSSR 28 +DG + EF++PGGSTSSR Sbjct: 27 VDGIDKLDIEFVEPGGSTSSR 47 >SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 9 KIEFLQPGGSTSSR 22 >SB_40170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 29.1 bits (62), Expect = 4.9 Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +1 Query: 460 RTIFAIAQS*XDAXFPTYSPERRDKDRDSYSRFSAERDSHRSEGEYXXERYVDR-KXYDG 636 RT+FA S FP P+ R DS S E+ S R G+ ++R + D Sbjct: 96 RTLFAHFASQGSTTFPLIKPDGRSDQFDSRSSKRPEKGSER--GDRRDRNELERARDSDR 153 Query: 637 KWADGNETRKXHPTRRKGPQKNLK 708 W G + R R++G ++ K Sbjct: 154 DWQRG-DGRPHREHRQEGREQESK 176 >SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 49 KIEFLQPGGSTSSR 62 >SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 16 KIEFLQPGGSTSSR 29 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 21 KIEFLQPGGSTSSR 34 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 72 PRAEFLQPGGSTSSR 28 P EFLQPGGST SR Sbjct: 85 PNIEFLQPGGSTRSR 99 >SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 3 KIEFLQPGGSTSSR 16 >SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 32 KIEFLQPGGSTSSR 45 >SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 75 PPRAEFLQPGGSTSSR 28 P EFLQPGGSTSSR Sbjct: 3 PFTIEFLQPGGSTSSR 18 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = -2 Query: 147 MISRHQIWTEIVEKRXXRRLDGTEPPRAEFLQPGGSTSSR 28 M SR+ + + +++ L GT EFLQPGGSTSSR Sbjct: 1 MPSRNPLVSLDIQRDYCPFLTGTR--LIEFLQPGGSTSSR 38 >SB_4873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 331 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 722 IIGLLFRFFWGPFLLVGCXFLVSFPS 645 I+G+ F FWGPFLLV +V FPS Sbjct: 219 ILGV-FLAFWGPFLLVD-FLMVQFPS 242 >SB_4841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 69 RAEFLQPGGSTSSR 28 + EFLQPGGSTSSR Sbjct: 3 KIEFLQPGGSTSSR 16 >SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 96 RRLDGTEPPRAEFLQPGGSTSSR 28 R G EFLQPGGSTSSR Sbjct: 7 RTQTGQSATLIEFLQPGGSTSSR 29 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 63 EFLQPGGSTSSR 28 EFLQPGGSTSSR Sbjct: 4 EFLQPGGSTSSR 15 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 63 EFLQPGGSTSSR 28 EFLQPGGSTSSR Sbjct: 5 EFLQPGGSTSSR 16 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 63 EFLQPGGSTSSR 28 EFLQPGGSTSSR Sbjct: 31 EFLQPGGSTSSR 42 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 63 EFLQPGGSTSSR 28 EFLQPGGSTSSR Sbjct: 7 EFLQPGGSTSSR 18 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 63 EFLQPGGSTSSR 28 EFLQPGGSTSSR Sbjct: 15 EFLQPGGSTSSR 26 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,168,390 Number of Sequences: 59808 Number of extensions: 315839 Number of successful extensions: 2543 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2518 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -