BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0265 (820 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.2 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 2.9 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.4 bits (48), Expect = 2.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 649 SYLPKIRALGLSVLKVGLASVKFLIDVVVRPIRSDSF 539 SYLP IRALG S K + + I V P++ +F Sbjct: 33 SYLPFIRALGKS--KKEFKTRTYFIYAFVAPVKCLAF 67 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 649 SYLPKIRALGLSVLKVGLASVKFLIDVVVRPIRSDSF 539 SYLP IRALG S K + + I V P++ +F Sbjct: 266 SYLPFIRALGKS--KKEFKTRTYFIYAFVAPVKCLAF 300 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 649 SYLPKIRALGLSVLKVGLASVKFLIDVVVRPIRSDSF 539 SYLP IRALG S K + + I V P++ +F Sbjct: 266 SYLPFIRALGKS--KKEFKTRTYFIYAFVAPVKCLAF 300 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 66 EVTQILYSNIQKLLPTQESRDLAE 137 EV Q+ +QK L T+E +DL + Sbjct: 19 EVAQVWEQTLQKGLDTEEIKDLLQ 42 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,784 Number of Sequences: 336 Number of extensions: 3621 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -