BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0263 (653 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces... 28 1.4 SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pomb... 25 7.2 >SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces pombe|chr 2|||Manual Length = 897 Score = 27.9 bits (59), Expect = 1.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 186 LLLHFLALNIFTIGIMFSML*LFKLNQPKEIYH 284 ++ HFL+L F I+FS+L F L P + +H Sbjct: 116 MIEHFLSLFAFCRTILFSLLTSFLLVPPPQFFH 148 >SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 814 Score = 25.4 bits (53), Expect = 7.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 627 NYNYNPR-FTKC*TFESIIHYFLNYSTIKNSFLSEQK 520 N+N+N + F+KC F + H+F K S EQK Sbjct: 268 NFNHNIKEFSKC-DFTQMFHHFEQKREEKKSMPKEQK 303 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,382,779 Number of Sequences: 5004 Number of extensions: 43780 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -