BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0263 (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0174 + 18919759-18920265,18920381-18920443,18921060-189217... 32 0.35 12_02_0318 - 17457182-17462232,17462745-17462955,17463356-174634... 28 5.6 >01_05_0174 + 18919759-18920265,18920381-18920443,18921060-18921761, 18922934-18923068,18923391-18923474,18924095-18924151, 18924290-18924376,18924963-18925205 Length = 625 Score = 32.3 bits (70), Expect = 0.35 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 604 YEML--NIRKYNSLLFKLLYNKKQLPIGTKVF*NKENKPKVIMTL 476 YE L + +KYN L +LL+N K P+ NKE P V++T+ Sbjct: 447 YEALGSDFQKYNQKLRQLLFNIKNSPVLRNRLMNKELDPPVLLTM 491 >12_02_0318 - 17457182-17462232,17462745-17462955,17463356-17463403, 17466161-17466346 Length = 1831 Score = 28.3 bits (60), Expect = 5.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 473 KQCHYYLWFVFFILKNFCSDRK 538 ++C YY+W F++K C D+K Sbjct: 299 EECTYYMWKQKFVVKPECRDKK 320 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,972,235 Number of Sequences: 37544 Number of extensions: 205126 Number of successful extensions: 259 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 259 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -