BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0262 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0029 - 25194827-25195095,25195129-25197970 28 6.2 11_06_0124 + 20348269-20348413,20348753-20348874,20349210-203493... 28 8.1 >02_05_0029 - 25194827-25195095,25195129-25197970 Length = 1036 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = +2 Query: 248 SHQTLTLGQTNSKISKKRILVPWTTEQKSAVLSYFKMHIKKRKPPKRGECETLKELYPDL 427 S+ TL+ G NS S K +L + Q+S YF IKK + K + P L Sbjct: 498 SNNTLSGGIPNSLTSMKGLLT-CNSSQQSTETDYFPFFIKKNRTGKGLRYNQVSSFPPSL 556 Query: 428 LSNKDWL 448 + + + L Sbjct: 557 ILSHNML 563 >11_06_0124 + 20348269-20348413,20348753-20348874,20349210-20349318, 20349401-20349440,20350245-20350334,20350388-20350547, 20350656-20350795,20351390-20351492,20351667-20352178, 20352267-20352543 Length = 565 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 293 KKRILVPWTTEQKSAVLSYFKMHIKK 370 ++R+ VPW ++ A+L YF++ K Sbjct: 187 EERVKVPWPVSEREALLHYFELEYLK 212 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,820,966 Number of Sequences: 37544 Number of extensions: 279414 Number of successful extensions: 605 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -