BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0257 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.9 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 21 7.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 104 NQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEA 226 N+I + W + D G AYHGD + E I ++A Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKA 951 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 404 DSVLDVVRKEAESCDCLQGF 463 D V RK AE C LQGF Sbjct: 233 DVVASNSRKTAEMCYKLQGF 252 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,771 Number of Sequences: 336 Number of extensions: 3298 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -