BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0257 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 25 0.95 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 25 0.95 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 5.1 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 24.6 bits (51), Expect = 0.95 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +2 Query: 401 VDSVLDVVRKEAESCDCLQG 460 +DS+++++R ++CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 24.6 bits (51), Expect = 0.95 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -1 Query: 130 LPELSSDLVAALTSLDMYDFPHFVLFM*TINY--LTLKMLSAR 8 L E + +L AL+S++ F HFVL M IN+ +T ++ AR Sbjct: 870 LVEFALELKKALSSINEQSFNHFVLKM-GINHGPVTAGVIGAR 911 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 247 GTYLPAGGFIVVY 209 GT+L +GGF +VY Sbjct: 70 GTFLGSGGFGIVY 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,163 Number of Sequences: 438 Number of extensions: 3935 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -