BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0255 (718 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 48 8e-08 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 48 8e-08 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 44 2e-06 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 25 0.46 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.5 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.3 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.3 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 48.0 bits (109), Expect = 8e-08 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +2 Query: 566 INEPTAAAIAYGLDQKGTGERNVLIFE 646 INEPTAAAIAYGLD+K ERNVLIF+ Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFD 27 Score = 35.5 bits (78), Expect = 4e-04 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +3 Query: 636 LSLNLGGRYFDVSIXTIEDGIFEVE 710 L +LGG FDVS+ TIE+GIFEV+ Sbjct: 24 LIFDLGGGTFDVSLLTIEEGIFEVK 48 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 48.0 bits (109), Expect = 8e-08 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +2 Query: 566 INEPTAAAIAYGLDQKGTGERNVLIFE 646 INEPTAAAIAYGLD+K ERNVLIF+ Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFD 27 Score = 35.5 bits (78), Expect = 4e-04 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +3 Query: 636 LSLNLGGRYFDVSIXTIEDGIFEVE 710 L +LGG FDVS+ TIE+GIFEV+ Sbjct: 24 LIFDLGGGTFDVSLLTIEEGIFEVK 48 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 43.6 bits (98), Expect = 2e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = +2 Query: 566 INEPTAAAIAYGLDQKGTGERNVLIFE 646 INEPTAAAIAYGLD+KG E+N+L+++ Sbjct: 1 INEPTAAAIAYGLDKKG-AEQNILVYD 26 Score = 33.5 bits (73), Expect = 0.002 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +3 Query: 636 LSLNLGGRYFDVSIXTIEDGIFEV 707 L +LGG FDVSI TI++G+FEV Sbjct: 23 LVYDLGGGTFDVSILTIDNGVFEV 46 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 25.4 bits (53), Expect = 0.46 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 624 SPVPFWSRP*AIAAAVGSLMIRRTFKP-EMVP 532 +P P W+RP + +A GS ++ T KP + VP Sbjct: 407 TPRPEWARPPSTPSADGSKPVQTTPKPGQWVP 438 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.5 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +3 Query: 339 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 464 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 111 LPAREGGDHRQRPGQQDH 164 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 521 TKDAGTISGLNVLRIINEPTAA 586 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,405 Number of Sequences: 336 Number of extensions: 4164 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -