BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0254 (804 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 25 0.71 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 2.2 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 22 6.6 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 25.0 bits (52), Expect = 0.71 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +3 Query: 495 KFHAIKPKPTSRPGPRSSQQRQSVMTKL-ETDLDSKPSSTPVAVKRP 632 K I P+P P P+ +Q +S T+ E +S + P K P Sbjct: 387 KSDEIPPEPVPTPEPQPTQTTESEPTQASEQPTESSTTQKPQTTKTP 433 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 193 PADIFAWKLFQHSENCSSDAMIATTRRGT 107 PA I ++ L QH CSS + +T T Sbjct: 221 PASIDSFTLEQHRSWCSSSQPVLSTTNST 249 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 540 RSSQQRQSVMTKLETDLDSKPSSTPVAVKRPN 635 R + Q ++TK ++ K + PVAV R N Sbjct: 27 RKNPQDDILLTKKKSKPGGKTAPQPVAVARRN 58 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,141 Number of Sequences: 336 Number of extensions: 3630 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -