BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0250 (715 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 4.3 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 21 7.5 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 9.9 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 463 VLCTTYKLQFFKWDTNRCKHCLYSSFIILS 374 V T + FFK N C +Y F+++S Sbjct: 158 VFGTMQRTSFFKTFLNSCLMDVYYEFLLIS 187 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 144 NLQEVLGDDKLTE 182 NL+E+L D+LTE Sbjct: 31 NLKEILQSDRLTE 43 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 327 ACKSANNIVTSQPAFKKSAIFNIG 256 AC SA+N++ P + N+G Sbjct: 309 ACMSASNLIQRTPNICYKLLSNLG 332 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,459 Number of Sequences: 336 Number of extensions: 3588 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -