BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0250 (715 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 2.4 AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synth... 23 7.2 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.0 bits (52), Expect = 2.4 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 441 FSFSSGT-PIDVSIAFIAAS*Y*VRSAKSSQG 349 FS S GT P+ VS+ A+S Y RSA+S G Sbjct: 841 FSPSGGTTPVPVSLLSPASSHYSQRSARSPYG 872 >AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synthase protein. Length = 142 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 172 LSSPKTSCKFRVIKCFFSCQVAMVNLWR 89 + S CK + FF C+ V+L+R Sbjct: 13 IKSEMVDCKIPKVWLFFGCRTKNVDLYR 40 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 679,011 Number of Sequences: 2352 Number of extensions: 13309 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -