BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0245 (666 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 23 1.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 5.2 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.2 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 6.9 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 6.9 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = -1 Query: 630 KSLXFDCNVGNIKLRYENVIKIWLYG 553 + L DCN+G + + +++YG Sbjct: 66 RRLEVDCNIGGYDFPKDTFLSLFIYG 91 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 24 VSFNFLYPVNSSRASERT--HTLFFF*YLILAYGP 122 + F+F Y +S+ ++ +TLFF Y+ L GP Sbjct: 268 IVFSFCYCYYNSKMTKDGVYNTLFFIVYVSLLLGP 302 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 497 IDTNHTHHTKKGXNVNGTKPYSQILITFSYLSFIFP 604 IDT TH K Y ++L+TF++ +FP Sbjct: 9 IDTRSTHSMKNFK-------YLKVLVTFAHFICLFP 37 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 320 YNVLRIQWSLTANHLNLTCMKKQYN 394 YN R+ S N LNLT K + N Sbjct: 130 YNESRVMMSPPGNVLNLTMPKYEPN 154 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 320 YNVLRIQWSLTANHLNLTCMKKQYN 394 YN R+ S N LNLT K + N Sbjct: 130 YNESRVMMSPPGNVLNLTMPKYEPN 154 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,057 Number of Sequences: 336 Number of extensions: 2871 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -