BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0244 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 24 1.1 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 21 8.1 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 8.1 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 8.1 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 390 YKRHYQLINRQLGRRLLKHSPEGFHIKKVRK 482 +K+ YQLIN Q+ R+ + F I +VRK Sbjct: 191 FKQRYQLINEQMAVRINPKNCASFVI-EVRK 220 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 279 DQLSFNCFNSLY*LFC*SIKFAN 347 D+L F C + C S+ F+N Sbjct: 149 DELLFKCMKEKWIPLCNSVTFSN 171 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 279 DQLSFNCFNSLY*LFC*SIKFAN 347 D+L F C + C S+ F+N Sbjct: 382 DELLFKCMKEKWIPLCNSVTFSN 404 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 279 DQLSFNCFNSLY*LFC*SIKFAN 347 D+L F C + C S+ F+N Sbjct: 382 DELLFKCMKEKWIPLCNSVTFSN 404 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,321 Number of Sequences: 336 Number of extensions: 2644 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -