BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0244 (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 27 0.62 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 27 0.62 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 5.8 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 26.6 bits (56), Expect = 0.62 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 483 SSLLSLYGNLRVSVLVSVDLTVYLLIDNDAYIV 385 S L LY N+ + ++D + + ++ NDAYIV Sbjct: 1042 SELQELYRNITSQIPFAIDPSKFGILVNDAYIV 1074 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 26.6 bits (56), Expect = 0.62 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 483 SSLLSLYGNLRVSVLVSVDLTVYLLIDNDAYIV 385 S L LY N+ + ++D + + ++ NDAYIV Sbjct: 1043 SELQELYRNITSQIPFAIDPSKFGILVNDAYIV 1075 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 414 NRQLGRRLLKHSPEGFHIKKVRKK 485 N+ + R LL+H P+G K+V+K+ Sbjct: 938 NKLIVRELLRHYPDGLQ-KEVKKE 960 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,358 Number of Sequences: 2352 Number of extensions: 9725 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -