BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0241 (647 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 3.1 SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch... 27 3.1 SPBC405.03c |||membrane transporter |Schizosaccharomyces pombe|c... 26 4.1 SPBC17A3.09c |||lipoate-protein ligase A |Schizosaccharomyces po... 26 4.1 SPAC29E6.05c ||SPAC30.09c|peptide methionine sulfoxide reductase... 25 7.1 SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||... 25 7.1 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 25 9.4 >SPAC23C4.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 104 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 86 LNLTSFYRDLELLLTLIFQFRYTDPRWTIN 175 LN+ + L+++ LIFQF T P W N Sbjct: 74 LNIALRIQSLKIIKILIFQFYSTKPLWDKN 103 >SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosaccharomyces pombe|chr 2|||Manual Length = 2352 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -2 Query: 502 IYRTDHRTLWYLLSVQKKPVFPYS*FPFQ---VWYLFVN 395 +Y + T W L S+ + P+ PY F Q +W +F N Sbjct: 615 LYGESNPTTWGLWSMIRGPLAPYQKFSDQNDYIWLIFTN 653 >SPBC405.03c |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 341 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 29 TAGTVILIVNSTVMVA*EYLNLTSFYRDLELLLTL 133 TAG ++LI+N+++ +YL + + LL+T+ Sbjct: 260 TAGLIVLIINASITFVSDYLWVIAMLMTSPLLVTV 294 >SPBC17A3.09c |||lipoate-protein ligase A |Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 26.2 bits (55), Expect = 4.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -3 Query: 510 HILSTVPTTEHCGTCYQSKKNLYFLILNFHFKCGICLL 397 H LS++P T G CY+S FLI H K I +L Sbjct: 322 HELSSIPWT---GLCYESGFANTFLISGIHSKEAISIL 356 >SPAC29E6.05c ||SPAC30.09c|peptide methionine sulfoxide reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 170 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -1 Query: 617 TLNLYGKHICSSRSPVIYTSNPKSVIIEKRTGHRAPTSYLP 495 T N G I + I+T+NP+ I KR + + P Sbjct: 85 TSNQQGNDIGTQYRSAIFTTNPEQATIAKRVMNEVQAKHYP 125 >SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 948 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 Query: 127 DLDISVQIYRPQVDNQYYNVERVSWQKKG 213 D+D+S+ R + N + V +V+W G Sbjct: 630 DVDVSINRIRKEKSNTIFTVPKVNWDDIG 658 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -3 Query: 510 HILSTVPTTEHCGTCYQSKKNLYFLILNFHFKCGICLLMFSFQCFAY 370 H+L + C Y +N FLIL+ + IC+ ++ + + Sbjct: 1281 HLLFLLTIFYPCPIAYTYVRNSIFLILSICYTINICVKVYGLSFYYF 1327 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,649,130 Number of Sequences: 5004 Number of extensions: 54789 Number of successful extensions: 130 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -