BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0241 (647 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1242 + 25113464-25114150 32 0.34 08_02_1111 + 24377268-24377444,24377543-24377630,24378072-243781... 28 7.4 >07_03_1242 + 25113464-25114150 Length = 228 Score = 32.3 bits (70), Expect = 0.34 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 510 HILSTVPTTEHCGTCYQSKKNLYFLILNFHFKCGICLLMFSFQC 379 H+L+ VP C C++ +H++CG+CL M C Sbjct: 133 HVLNLVPARGECAACHRDCSI-------WHYRCGLCLFMLHIGC 169 >08_02_1111 + 24377268-24377444,24377543-24377630,24378072-24378157, 24378358-24378511,24378723-24378883,24378964-24379632, 24379860-24380058,24380188-24380405,24380578-24380755, 24380859-24381358 Length = 809 Score = 27.9 bits (59), Expect = 7.4 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = -3 Query: 339 WIWTLEWRPPPVLSTD 292 W++++EW+PP +L+ D Sbjct: 319 WVYSVEWQPPTLLTDD 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,415,854 Number of Sequences: 37544 Number of extensions: 321420 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -