BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0240 (745 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1131 + 24190675-24190814,24190938-24191021,24191628-241917... 37 0.015 12_02_0782 + 23114532-23114596,23116259-23116316,23116445-231165... 28 6.8 12_02_0507 + 19810446-19811048,19811220-19811466,19811590-198121... 28 9.0 11_06_0732 - 26740718-26741704,26741876-26742478 28 9.0 10_02_0149 - 5873273-5874514,5874826-5875731,5875903-5876505 28 9.0 08_01_0973 + 9803917-9804519,9804691-9805596,9805908-9807149 28 9.0 07_03_0457 - 18404577-18405193,18405317-18405563,18405734-184059... 28 9.0 07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922,291... 28 9.0 06_03_0228 - 18439659-18440900,18441212-18441736,18441813-184421... 28 9.0 06_01_1011 + 7879283-7879885,7880057-7880962,7881274-7882515 28 9.0 05_03_0226 - 10645036-10646001,10646313-10646828,10646905-106472... 28 9.0 05_01_0180 + 1268129-1268237,1268382-1268731,1268903-1269808,127... 28 9.0 04_03_0383 + 15179587-15180162,15180334-15181149,15181548-15182789 28 9.0 04_03_0328 + 14440877-14441479,14441650-14441955,14442032-14442637 28 9.0 04_03_0101 - 11242252-11243295,11243607-11244131,11244208-112445... 28 9.0 >07_03_1131 + 24190675-24190814,24190938-24191021,24191628-24191735, 24193212-24193266,24193360-24193404 Length = 143 Score = 37.1 bits (82), Expect = 0.015 Identities = 27/113 (23%), Positives = 53/113 (46%), Gaps = 1/113 (0%) Frame = +2 Query: 188 DTVTRYENFINEVLKEDL-RELERN*SFFNNEVSDLIQQKHTLKVLTNKNIHPTGFKTQV 364 + V ++E+F++ LK DL + + F + + + K ++ L + T ++ V Sbjct: 13 EKVKKFEDFVDRRLKPDLVNTIAQRDKVFQQQKT-FLDLKRNIENLEKNGV--TSMRSMV 69 Query: 365 NVGCNFFMEASVSKTDTLLVNIGLNHYIEFKLSEANRFLEARIKSYEKNLMRY 523 N+G + V T + V+IGL ++EF EA +F+ R + + Y Sbjct: 70 NLG------SEVPDTRHIFVDIGLGFHVEFTWQEALQFISVRESRLARQIDEY 116 >12_02_0782 + 23114532-23114596,23116259-23116316,23116445-23116516, 23117468-23117587,23117668-23117769,23118254-23118274 Length = 145 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/44 (25%), Positives = 25/44 (56%) Frame = +2 Query: 383 FMEASVSKTDTLLVNIGLNHYIEFKLSEANRFLEARIKSYEKNL 514 + A + TD++ + +G N +E+ EAN L+ +++ + +L Sbjct: 78 YSRAKIEDTDSVCLWLGANVMLEYSCDEANALLKKNLENAKASL 121 >12_02_0507 + 19810446-19811048,19811220-19811466,19811590-19812125, 19812397-19813620 Length = 869 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 233 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 267 >11_06_0732 - 26740718-26741704,26741876-26742478 Length = 529 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 233 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 267 >10_02_0149 - 5873273-5874514,5874826-5875731,5875903-5876505 Length = 916 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 233 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 267 >08_01_0973 + 9803917-9804519,9804691-9805596,9805908-9807149 Length = 916 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 233 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 267 >07_03_0457 - 18404577-18405193,18405317-18405563,18405734-18405953, 18406239-18406333 Length = 392 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 137 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 171 >07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922, 2916053-2916113,2916243-2916365,2916505-2916537, 2916617-2916709,2916839-2916934,2917025-2917203, 2917344-2917530,2918051-2918184,2918311-2918518, 2918598-2918633,2918785-2919241,2919633-2919736, 2920489-2920569,2920646-2920697,2920837-2920876, 2920991-2921085,2921241-2921383,2921899-2922006, 2922120-2922221,2922302-2922348,2922425-2922554, 2923173-2923304,2923404-2923616,2923709-2923963, 2924053-2924799 Length = 1460 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -2 Query: 684 FYET*YTEHNNSLLQIIHTVALSTRTITIV 595 F ET + +HN+ +LQ+I ++ +T+TI + Sbjct: 1289 FLETHFGQHNDIILQMIKSLQKATKTIQTI 1318 >06_03_0228 - 18439659-18440900,18441212-18441736,18441813-18442118, 18442290-18442877 Length = 886 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 228 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 262 >06_01_1011 + 7879283-7879885,7880057-7880962,7881274-7882515 Length = 916 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 233 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 267 >05_03_0226 - 10645036-10646001,10646313-10646828,10646905-10647210, 10647382-10647984 Length = 796 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 233 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 267 >05_01_0180 + 1268129-1268237,1268382-1268731,1268903-1269808, 1270120-1271361 Length = 868 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 185 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 219 >04_03_0383 + 15179587-15180162,15180334-15181149,15181548-15182789 Length = 877 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 224 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 258 >04_03_0328 + 14440877-14441479,14441650-14441955,14442032-14442637 Length = 504 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 233 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 267 >04_03_0101 - 11242252-11243295,11243607-11244131,11244208-11244513, 11244692-11245231 Length = 804 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 740 GIYTV*GFTNLKYIYLDKNSMKHSTPNIITVYSKL 636 G +T G+ NLK Y + +++HST I ++ L Sbjct: 212 GAWTTRGYQNLKAKYFQRANLRHSTKQIKNRFTHL 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,911,655 Number of Sequences: 37544 Number of extensions: 280626 Number of successful extensions: 576 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1968901276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -