BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0235 (803 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 106 2e-23 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 50 2e-06 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 48 1e-05 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 46 4e-05 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 44 1e-04 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 44 2e-04 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 44 2e-04 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 42 5e-04 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 42 5e-04 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 40 0.003 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 40 0.003 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 39 0.003 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 39 0.003 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 39 0.003 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 39 0.004 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 39 0.004 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 38 0.006 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 38 0.008 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 38 0.008 At5g51300.2 68418.m06360 splicing factor-related contains simila... 38 0.008 At5g51300.1 68418.m06359 splicing factor-related contains simila... 38 0.008 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 38 0.008 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 38 0.010 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 38 0.010 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 38 0.010 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 37 0.014 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 37 0.014 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 37 0.018 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 36 0.024 At1g45100.1 68414.m05170 polyadenylate-binding protein, putative... 36 0.024 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 36 0.031 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 36 0.031 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 36 0.031 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.031 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 35 0.055 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 35 0.055 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 35 0.055 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 35 0.073 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 35 0.073 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 35 0.073 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 35 0.073 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 35 0.073 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 35 0.073 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 35 0.073 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 35 0.073 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 35 0.073 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 35 0.073 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 34 0.096 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 34 0.096 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 34 0.096 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 34 0.096 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 34 0.096 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 34 0.096 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 34 0.096 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 34 0.096 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 34 0.096 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 34 0.096 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 34 0.096 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 34 0.13 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 34 0.13 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 34 0.13 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 34 0.13 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 33 0.17 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 33 0.17 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 33 0.17 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 0.17 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 33 0.17 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 33 0.17 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.22 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 33 0.22 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 33 0.22 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 33 0.22 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 33 0.22 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 33 0.22 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 33 0.22 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 33 0.29 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 33 0.29 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 33 0.29 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 33 0.29 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 33 0.29 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 32 0.39 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 32 0.39 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 32 0.39 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 32 0.39 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 32 0.39 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 32 0.39 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 32 0.39 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 32 0.39 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 32 0.51 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 32 0.51 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 32 0.51 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 32 0.51 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 32 0.51 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 31 0.68 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 31 0.68 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 31 0.68 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 31 0.68 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 31 0.68 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 31 0.68 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 31 0.90 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 31 0.90 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 31 1.2 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 31 1.2 At5g41690.1 68418.m05067 polyadenylate-binding protein, putative... 31 1.2 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 31 1.2 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 31 1.2 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 31 1.2 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 31 1.2 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 31 1.2 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 31 1.2 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 30 1.6 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 30 1.6 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 30 1.6 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 30 1.6 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 30 1.6 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 30 1.6 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 30 1.6 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 30 1.6 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 30 1.6 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 2.1 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 2.1 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 30 2.1 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 30 2.1 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 30 2.1 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 30 2.1 At1g66260.1 68414.m07522 RNA and export factor-binding protein, ... 30 2.1 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 2.7 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 29 3.6 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 29 3.6 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 29 3.6 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 29 3.6 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 29 3.6 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 29 3.6 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 29 3.6 At1g09890.1 68414.m01113 expressed protein ; expression supporte... 29 3.6 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 29 4.8 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 29 4.8 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 29 4.8 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 28 6.3 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 28 8.3 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 28 8.3 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 28 8.3 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 28 8.3 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 106 bits (254), Expect = 2e-23 Identities = 45/62 (72%), Positives = 53/62 (85%) Frame = +3 Query: 321 GDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 500 G G PGPQRSVEGWI+ VS VHEE QEEDI N F +FGEIKN++LNLDRR+G++KGYAL Sbjct: 81 GSDGRPGPQRSVEGWIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYAL 140 Query: 501 VE 506 +E Sbjct: 141 IE 142 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = +2 Query: 509 ETYKQAASAREALDGADILGQAISVDWCFVKGPTKSHKKRR 631 E ++A SA A++GA++L Q +SVDW F GP+ RR Sbjct: 144 EKKEEAQSAISAMNGAELLTQNVSVDWAFSSGPSGGESYRR 184 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/72 (30%), Positives = 40/72 (55%) Frame = +3 Query: 288 NRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD 467 N R+ L+P+ +S TP ++ LFVS + + E ++ F++FGE+ + + D Sbjct: 31 NASRFSFLSPQAESQTPARPQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTD 90 Query: 468 RRTGFLKGYALV 503 R +G+ KG+ V Sbjct: 91 RVSGYSKGFGFV 102 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/82 (37%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Frame = +3 Query: 273 AAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQN----QFSEFGE 440 A ERG RG + P+ + G E I FV E+DI+N FS GE Sbjct: 372 AQERGERGERPAFTPQSGNFRSGGDGGDEKKI-FVKGFDASLSEDDIKNTLREHFSSCGE 430 Query: 441 IKNIHLNLDRRTGFLKGYALVE 506 IKN+ + +DR TG KG A +E Sbjct: 431 IKNVSVPIDRDTGNSKGIAYLE 452 Score = 35.5 bits (78), Expect = 0.042 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +3 Query: 333 TPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 TP + LF +N+ + D++N F E GE+ ++ + +R G +G+ VE Sbjct: 287 TPSTPAAGGSKTLFAANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVE 344 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 LFVS ++ E+ E I+ +F +G IK +HL D+ T KGYA +E Sbjct: 140 LFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIE 185 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +3 Query: 285 GNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 464 G RGR S +P G G G R + +L V N+ + ++ED++ F +FG +K+I+L Sbjct: 15 GRRGR--SPSPRGRYG--GRSRDLPTSLL-VRNLRHDCRQEDLRKSFEQFGPVKDIYLPR 69 Query: 465 DRRTGFLKGYALVE 506 D TG +G+ V+ Sbjct: 70 DYYTGDPRGFGFVQ 83 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 5/88 (5%) Frame = +3 Query: 255 EAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWIL-----FVSNVHEEAQEEDIQN 419 EAGG + G D++ EGD ++V +L FV N+ A EE++ Sbjct: 225 EAGGVGKDDDG-----DAMEVEGDGKVAQESKAVSDDVLDTGRLFVRNLPYTATEEELME 279 Query: 420 QFSEFGEIKNIHLNLDRRTGFLKGYALV 503 FS FG+I +HL LD+ T +G A + Sbjct: 280 HFSTFGKISEVHLVLDKETKRSRGIAYI 307 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/74 (33%), Positives = 41/74 (55%) Frame = +3 Query: 285 GNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 464 G RGR S +P G G G + S L V N+ + ++ED++ F +FG +K+I+L Sbjct: 15 GRRGR--SPSPRGRFG--GSRDSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPR 70 Query: 465 DRRTGFLKGYALVE 506 D TG +G+ ++ Sbjct: 71 DYYTGDPRGFGFIQ 84 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/81 (25%), Positives = 36/81 (44%) Frame = +3 Query: 264 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 443 G S A RGR P + +P + E +L V ++ E ++ F FGE+ Sbjct: 65 GKSPAGPARRGRSPPPPPSKGASSPSKKAVQESLVLHVDSLSRNVNEAHLKEIFGNFGEV 124 Query: 444 KNIHLNLDRRTGFLKGYALVE 506 ++ + +DR +G+ VE Sbjct: 125 IHVEIAMDRAVNLPRGHGYVE 145 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/81 (25%), Positives = 36/81 (44%) Frame = +3 Query: 264 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 443 G S A RGR P + +P + E +L V ++ E ++ F FGE+ Sbjct: 65 GKSPAGPARRGRSPPPPPSKGASSPSKKAVQESLVLHVDSLSRNVNEAHLKEIFGNFGEV 124 Query: 444 KNIHLNLDRRTGFLKGYALVE 506 ++ + +DR +G+ VE Sbjct: 125 IHVEIAMDRAVNLPRGHGYVE 145 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/86 (27%), Positives = 39/86 (45%) Frame = +3 Query: 246 FWQEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQF 425 + E GGG ++R G S SG+ S G L+V N+ + ++N F Sbjct: 210 YGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLF 269 Query: 426 SEFGEIKNIHLNLDRRTGFLKGYALV 503 +E G++ + DR +G KG+ V Sbjct: 270 NEQGKVVEARVIYDRDSGRSKGFGFV 295 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/86 (27%), Positives = 39/86 (45%) Frame = +3 Query: 246 FWQEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQF 425 + E GGG ++R G S SG+ S G L+V N+ + ++N F Sbjct: 218 YGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLF 277 Query: 426 SEFGEIKNIHLNLDRRTGFLKGYALV 503 +E G++ + DR +G KG+ V Sbjct: 278 NEQGKVVEARVIYDRDSGRSKGFGFV 303 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +3 Query: 285 GNRGRYDSLAPE----GDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNI 452 G RGR P G G G +R L V N+ + + E+++ F FG ++++ Sbjct: 17 GGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDV 76 Query: 453 HLNLDRRTGFLKGYALVE 506 ++ D +G +G+A VE Sbjct: 77 YIPRDYYSGQPRGFAFVE 94 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/45 (31%), Positives = 31/45 (68%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 F S++ E+ ++++++ FS+ GE+ +H+ DR TG +G+A ++ Sbjct: 486 FSSSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYID 530 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/58 (32%), Positives = 27/58 (46%) Frame = +3 Query: 333 TPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 TP Q LF N+ + DI+N F E GE+ ++ L+ G KGY +E Sbjct: 374 TPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAGEVVDVRLS-SFDDGSFKGYGHIE 430 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 500 ++VSNV + + + FS FGEI+ L LD+ TG KG+AL Sbjct: 229 IYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFAL 272 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + + + + + + F ++GEI++ +D+ +G KGY + Sbjct: 130 IFVHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFI 174 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +3 Query: 357 EGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 EG +FV + E + D++ FS FG+I + + L+R TG +G+ + Sbjct: 5 EGSRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFI 53 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/66 (36%), Positives = 32/66 (48%) Frame = +3 Query: 306 SLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 485 S AP G SG P +S L+VSN+ DI FS FG++ + + DR T Sbjct: 42 SSAPGGGSGGLAPSKST----LYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQS 97 Query: 486 KGYALV 503 +G A V Sbjct: 98 RGVAFV 103 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +3 Query: 321 GDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 500 G T P +FV+NVH A ++ + F++FGE+ + D TG G A Sbjct: 502 GTLSTTRPLEDASSRTIFVANVHFGATKDSLSRHFNKFGEVLKAFIVTDPATGQPSGSAY 561 Query: 501 VE 506 +E Sbjct: 562 IE 563 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +3 Query: 330 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G GP + + L V N+ +D+ F+++G++ ++ + DRRTG +G+A V Sbjct: 5 GRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFV 62 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +3 Query: 330 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G GP + + L V N+ +D+ F+++G++ ++ + DRRTG +G+A V Sbjct: 5 GRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFV 62 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 37.9 bits (84), Expect = 0.008 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 1/84 (1%) Frame = +3 Query: 258 AGGGSAAERGNRGRYDSLAPE-GDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEF 434 + G + N G S P G + T P + + L++ + +++ + N FS F Sbjct: 444 SSGSNPPWANNAGNGASAHPGLGSTPTKPPSKEYDETNLYIGFLPPMLEDDGLINLFSSF 503 Query: 435 GEIKNIHLNLDRRTGFLKGYALVE 506 GEI + DR TG KGY V+ Sbjct: 504 GEIVMAKVIKDRVTGLSKGYGFVK 527 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 37.9 bits (84), Expect = 0.008 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 1/84 (1%) Frame = +3 Query: 258 AGGGSAAERGNRGRYDSLAPE-GDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEF 434 + G + N G S P G + T P + + L++ + +++ + N FS F Sbjct: 444 SSGSNPPWANNAGNGASAHPGLGSTPTKPPSKEYDETNLYIGFLPPMLEDDGLINLFSSF 503 Query: 435 GEIKNIHLNLDRRTGFLKGYALVE 506 GEI + DR TG KGY V+ Sbjct: 504 GEIVMAKVIKDRVTGLSKGYGFVK 527 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 37.9 bits (84), Expect = 0.008 Identities = 25/73 (34%), Positives = 33/73 (45%) Frame = +3 Query: 288 NRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD 467 N G YD P GDS G LFV + E+ ++ S++G IKN+ L Sbjct: 46 NAGLYD---PSGDSKAVGDPYCT----LFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRH 98 Query: 468 RRTGFLKGYALVE 506 TG +GY VE Sbjct: 99 IVTGASRGYGFVE 111 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 37.5 bits (83), Expect = 0.010 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 500 ++VSNV E + + FS+FGEI+ L LD+ TG KG+ L Sbjct: 247 IYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCL 290 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + + + E + F ++GEI++ D+ +G KGY + Sbjct: 142 IFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 37.5 bits (83), Expect = 0.010 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 500 ++VSNV E + + FS+FGEI+ L LD+ TG KG+ L Sbjct: 247 IYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCL 290 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + + + E + F ++GEI++ D+ +G KGY + Sbjct: 142 IFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 37.5 bits (83), Expect = 0.010 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 500 ++VSNV E + + FS+FGEI+ L LD+ TG KG+ L Sbjct: 247 IYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCL 290 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + + + E + F ++GEI++ D+ +G KGY + Sbjct: 142 IFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +F+ + + EED+++ E GEI + L DR +G KGYA V Sbjct: 118 VFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFV 162 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 37.1 bits (82), Expect = 0.014 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +3 Query: 312 APEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKG 491 A G G GP S L+V N+H E+D++ F FG ++ + + D TG KG Sbjct: 269 AAAGAGGMLGPY-SGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRD-ETGLCKG 326 Query: 492 YALVE 506 + V+ Sbjct: 327 FGFVQ 331 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/57 (28%), Positives = 33/57 (57%) Frame = +3 Query: 318 EGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 +G+SG P + +FV V + E+D+++ F +FGE+ ++ + +R GF++ Sbjct: 267 QGNSGESDPTNTT----IFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQ 319 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 36.3 bits (80), Expect = 0.024 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 L+V N+H E ++ F FG ++ + L LD TG KG+ ++ Sbjct: 267 LYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQ 312 >At1g45100.1 68414.m05170 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Nicotiana tabacum] GI:7673355, [Cucumis sativus] GI:7528270; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 497 Score = 36.3 bits (80), Expect = 0.024 Identities = 24/72 (33%), Positives = 37/72 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE*RLINKPLVHVKHW 548 LFVS + + + DI + FS+ GE+ N+ + L TG AL+ L+ + H K Sbjct: 66 LFVSELSRQTKISDIIDFFSDVGEVVNVRICLS-HTGSCCVLALLSFLLLVRQTRHWKRR 124 Query: 549 MAQIYSAKRYQL 584 M I + KR+ L Sbjct: 125 MVNICTIKRFLL 136 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 LFV+N+ + Q DI N F + GE+ ++ L ++ + G G+ VE Sbjct: 249 LFVANLRDSIQISDIINFFKDVGEVVHVRLIVNSQ-GKHAGWGFVE 293 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 35.9 bits (79), Expect = 0.031 Identities = 18/64 (28%), Positives = 33/64 (51%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 LA G+ GT + ++V+NV + + + N F +G+++ L D+ TG + Sbjct: 149 LAASGNQGTGSQIADISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSR 208 Query: 489 GYAL 500 G+AL Sbjct: 209 GFAL 212 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE*RLINKPLVHVK 542 LF+ + + E +++ FS +G+++ + LD+ TG KGY V ++ L+ +K Sbjct: 77 LFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALK 134 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 35.9 bits (79), Expect = 0.031 Identities = 18/64 (28%), Positives = 33/64 (51%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 LA G+ GT + ++V+NV + + + N F +G+++ L D+ TG + Sbjct: 149 LAASGNQGTGSQIADISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSR 208 Query: 489 GYAL 500 G+AL Sbjct: 209 GFAL 212 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE*RLINKPLVHVK 542 LF+ + + E +++ FS +G+++ + LD+ TG KGY V ++ L+ +K Sbjct: 77 LFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALK 134 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 35.9 bits (79), Expect = 0.031 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = +3 Query: 273 AAERGNRGRYDSLAPEGDSGTPGPQRSVEG--WILFVSNVHEEAQEEDIQNQFSEFGEIK 446 AA G + +L G G G E +FV + + EED+ FS+FGE+ Sbjct: 295 AAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVV 354 Query: 447 NIHLNLDRRTGFLK 488 ++ + + + GF++ Sbjct: 355 SVKIPVGKGCGFVQ 368 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.9 bits (79), Expect = 0.031 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +3 Query: 267 GSAAERGNRGRYDSLAPEGDSGT-PGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 443 G A R G Y +GT P+ + +FV + +ED++ F+EFGEI Sbjct: 272 GPATPRKTNG-YQQQGGYMPNGTLTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEI 330 Query: 444 KNIHLNLDRRTGFLK 488 ++ + + + GF++ Sbjct: 331 VSVKIPVGKGCGFVQ 345 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 35.1 bits (77), Expect = 0.055 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 339 GPQRSVE-GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G S+E G L++SN+ EDI+ FSE G++K ++ D R+G KG A V Sbjct: 99 GGGSSIETGTKLYISNLDYGVSNEDIKELFSEVGDLKRYGIHYD-RSGRSKGTAEV 153 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 35.1 bits (77), Expect = 0.055 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 FV + E+ I+ F+EFGE+ + + +DR TG KG+ V Sbjct: 47 FVGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFV 90 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 35.1 bits (77), Expect = 0.055 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E Q E ++ F ++GEI + D+ TG KGY V Sbjct: 26 VFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFV 70 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 34.7 bits (76), Expect = 0.073 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 LFV +V A EE+I+ F + G + + L D+RTG +G V+ Sbjct: 122 LFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVK 167 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/45 (31%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD-----RRTGFLK 488 LFV +++++A E++++ F +FG +++++L D R GF+K Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVK 257 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 34.7 bits (76), Expect = 0.073 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 LFV +V A EE+I+ F + G + + L D+RTG +G V+ Sbjct: 122 LFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVK 167 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/45 (31%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD-----RRTGFLK 488 LFV +++++A E++++ F +FG +++++L D R GF+K Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVK 257 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 34.7 bits (76), Expect = 0.073 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 LF+ + E+ +++ FS FGE+ + + D+ +G +G+ V+ Sbjct: 43 LFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVD 88 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 34.7 bits (76), Expect = 0.073 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ + + EE ++ FS FGE+ + DR TG +G+ V Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFV 52 Score = 31.1 bits (67), Expect = 0.90 Identities = 27/112 (24%), Positives = 45/112 (40%), Gaps = 7/112 (6%) Frame = +3 Query: 297 RYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRT 476 R +S + +G G PG R + FV + E D + F +FG ++ + D T Sbjct: 91 RSNSSSIQGSPGGPGRTRKI-----FVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNT 145 Query: 477 GFLKGYALV---E*RLINKPLVHVKH----WMAQIYSAKRYQLIGASSRDPL 611 +G+ + + K L+ H M ++ A +L SR PL Sbjct: 146 QRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPGPSRSPL 197 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 34.7 bits (76), Expect = 0.073 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ + + EE ++ FS FGE+ + DR TG +G+ V Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFV 52 Score = 31.1 bits (67), Expect = 0.90 Identities = 27/112 (24%), Positives = 45/112 (40%), Gaps = 7/112 (6%) Frame = +3 Query: 297 RYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRT 476 R +S + +G G PG R + FV + E D + F +FG ++ + D T Sbjct: 91 RSNSSSIQGSPGGPGRTRKI-----FVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNT 145 Query: 477 GFLKGYALV---E*RLINKPLVHVKH----WMAQIYSAKRYQLIGASSRDPL 611 +G+ + + K L+ H M ++ A +L SR PL Sbjct: 146 QRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPGPSRSPL 197 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 34.7 bits (76), Expect = 0.073 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E Q + ++ F +FGEI + D+ TG KGY V Sbjct: 24 IFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFV 68 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 34.7 bits (76), Expect = 0.073 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E ++ FS++GE+ + + +DR TG +G+A V Sbjct: 36 IFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFV 80 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 34.7 bits (76), Expect = 0.073 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 +FV + +ED++ FSEFGEI ++ + + + GF++ Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQ 347 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 34.7 bits (76), Expect = 0.073 Identities = 18/75 (24%), Positives = 37/75 (49%) Frame = +3 Query: 264 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 443 G +A+++G G+ DS T +FV + ++ ++N FS++GEI Sbjct: 230 GPAASKKGVTGQRDSYQSSAAGVTT--DNDPNNTTVFVGGLDASVTDDHLKNVFSQYGEI 287 Query: 444 KNIHLNLDRRTGFLK 488 ++ + +R GF++ Sbjct: 288 VHVKIPAGKRCGFVQ 302 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 34.7 bits (76), Expect = 0.073 Identities = 18/75 (24%), Positives = 37/75 (49%) Frame = +3 Query: 264 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 443 G +A+++G G+ DS T +FV + ++ ++N FS++GEI Sbjct: 230 GPAASKKGVTGQRDSYQSSAAGVTT--DNDPNNTTVFVGGLDASVTDDHLKNVFSQYGEI 287 Query: 444 KNIHLNLDRRTGFLK 488 ++ + +R GF++ Sbjct: 288 VHVKIPAGKRCGFVQ 302 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 34.3 bits (75), Expect = 0.096 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ + E+ ++ F+++GE+ + + LDR TG +G+ V Sbjct: 42 LFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFV 86 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 34.3 bits (75), Expect = 0.096 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = +3 Query: 360 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G L++SN+ EDI+ F+E GE+K ++ D R+G KG A V Sbjct: 85 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFD-RSGRSKGTAEV 131 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 34.3 bits (75), Expect = 0.096 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = +3 Query: 360 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G L++SN+ EDI+ F+E GE+K ++ D R+G KG A V Sbjct: 21 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFD-RSGRSKGTAEV 67 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 34.3 bits (75), Expect = 0.096 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = +3 Query: 360 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G L++SN+ EDI+ F+E GE+K ++ D R+G KG A V Sbjct: 87 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFD-RSGRSKGTAEV 133 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 34.3 bits (75), Expect = 0.096 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 354 VEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +E LF+ + E E+ +++ F FGE+ + DR TG +G+ V Sbjct: 3 MESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFV 52 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 330 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G+PGP S + +FV + E + + F++FG I ++ + D RT +G+ + Sbjct: 98 GSPGPSNSKK---IFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFI 152 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 34.3 bits (75), Expect = 0.096 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 354 VEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +E LF+ + E E+ +++ F FGE+ + DR TG +G+ V Sbjct: 3 MESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFV 52 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 330 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G+PGP S + +FV + E + + F++FG I ++ + D RT +G+ + Sbjct: 98 GSPGPSNSKK---IFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFI 152 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 34.3 bits (75), Expect = 0.096 Identities = 21/63 (33%), Positives = 26/63 (41%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 L P G GP R +FV + E ++ FG +K L DR TG K Sbjct: 347 LTPGASGGLEGPDR------IFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSK 400 Query: 489 GYA 497 GYA Sbjct: 401 GYA 403 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 34.3 bits (75), Expect = 0.096 Identities = 21/63 (33%), Positives = 26/63 (41%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 L P G GP R +FV + E ++ FG +K L DR TG K Sbjct: 347 LTPGASGGLEGPDR------IFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSK 400 Query: 489 GYA 497 GYA Sbjct: 401 GYA 403 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 34.3 bits (75), Expect = 0.096 Identities = 21/63 (33%), Positives = 26/63 (41%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 L P G GP R +FV + E ++ FG +K L DR TG K Sbjct: 347 LTPGASGGLEGPDR------IFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSK 400 Query: 489 GYA 497 GYA Sbjct: 401 GYA 403 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 34.3 bits (75), Expect = 0.096 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 500 L+V + ++D++ +FS+FG+I++ +R+T F+ Y + Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKIEDFRFLRERKTAFIDYYEM 295 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 34.3 bits (75), Expect = 0.096 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +3 Query: 366 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 +LFV +H + +I++ S++G +K I +R +G KGY VE Sbjct: 203 MLFVGELHWWTTDAEIESVLSQYGRVKEIKFFDERVSGKSKGYCQVE 249 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 330 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 G+PGP S + +FV + E + + F++FG I ++ + D RT +G+ + Sbjct: 25 GSPGPSNSKK---IFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFI 79 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +3 Query: 366 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +L V + E+A EE ++ +FS+ IK++ L D+ T +G+A V Sbjct: 459 VLVVRGLDEDADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFV 504 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 ++V + + E D+ FS++GEI +++L D+ TG KG+A + Sbjct: 38 VYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFL 82 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E Q E ++ F ++G+I + D+ TG KGY V Sbjct: 26 VFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFV 70 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/74 (24%), Positives = 34/74 (45%) Frame = +3 Query: 285 GNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 464 G R + AP G P+ + ++V N+ + ++ FSE G++ + + Sbjct: 181 GRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVS 240 Query: 465 DRRTGFLKGYALVE 506 DR TG +G+ V+ Sbjct: 241 DRETGRSRGFGFVQ 254 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 F+SN+ +AQEEDI+ F + G + +I + + TG +G A + Sbjct: 654 FISNLSVKAQEEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYAD 698 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 F+SN+ +AQEEDI+ F + G + +I + + TG +G A + Sbjct: 654 FISNLSVKAQEEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYAD 698 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 33.5 bits (73), Expect = 0.17 Identities = 11/40 (27%), Positives = 26/40 (65%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 +FV + + +ED++ FS+FGE+ ++ + + + GF++ Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQ 362 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/81 (22%), Positives = 38/81 (46%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE*RLINKPLVHVKHW 548 +FV ++ + A EED++ F GE+ + + + +T KG A + + + VK Sbjct: 216 IFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKEL 275 Query: 549 MAQIYSAKRYQLIGASSRDPL 611 + + + K+ + + D L Sbjct: 276 KSPMINGKKCGVTASQDNDTL 296 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV V E E N F +FGE+ + + DR TG +G+ V Sbjct: 68 LFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFV 112 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + +E++++N F +G+I + D TG +G+ V Sbjct: 159 IFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFV 203 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 FV + +ED+Q FS+FG++ + + DR +G +G+ V Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFV 52 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 FV + +ED+Q FS+FG++ + + DR +G +G+ V Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFV 52 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 FV + +ED+Q FS+FG++ + + DR +G +G+ V Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFV 52 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 FV + +ED+Q FS+FG++ + + DR +G +G+ V Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFV 52 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFVS + E +Q+ F+ FG++ + + DR +G KG+ V Sbjct: 36 LFVSGLSRLTTNEKLQDAFASFGQLVDARVITDRDSGRSKGFGFV 80 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E ++++ F +FGEI + D+ TG KGY V Sbjct: 19 VFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFV 63 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E ++++ F +FGEI + D+ TG KGY V Sbjct: 19 VFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFV 63 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV + E ++ FSEFG++ N+ + + RT GY V Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYV 104 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV + E ++ FSEFG++ N+ + + RT GY V Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYV 123 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + +E+++ F +GEI+ + +D+ TG KGY V Sbjct: 410 IFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFV 454 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +3 Query: 366 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 +LFV ++ ++ED+ FS FG + + + D +TG YA +E Sbjct: 244 VLFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIE 290 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E ++++ F +FGEI + D+ TG KGY V Sbjct: 19 VFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFV 63 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +++ NV EE + FS GEIK I + LD+ T G+ V Sbjct: 36 VYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFV 80 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 + V N+ E+ ++ +FS FGEI + L D KGYA ++ Sbjct: 42 IMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQ 87 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV + E E+ ++ F+ +GE+ + D+ TG +G+ V Sbjct: 8 LFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFV 52 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/46 (30%), Positives = 30/46 (65%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 LF+ N+ + +E+++ +F+ FGE++++ L L + T +G A V+ Sbjct: 563 LFIRNLPFDVTKEEVKQRFTVFGEVESLSLVLHKVTKRPEGTAFVK 608 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 464 +V N+ + +E D++N FS+FG++ IH N+ Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDV--IHSNV 39 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E +E ++ F +FGEI + D+ +G KGY V Sbjct: 15 VFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFV 59 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E +E ++ F +FGEI + D+ +G KGY V Sbjct: 15 VFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFV 59 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E +E ++ F +FGEI + D+ +G KGY V Sbjct: 15 VFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFV 59 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + +++ + F +FGE+K + D TG +G+ V Sbjct: 132 IFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFV 176 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E + F ++GEI + + DR+TG +G+ V Sbjct: 44 IFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFV 88 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 31.9 bits (69), Expect = 0.51 Identities = 11/47 (23%), Positives = 27/47 (57%) Frame = +3 Query: 366 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 +L++ + E +I+ FS+FG +K + + +++TG K + ++ Sbjct: 61 VLYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQ 107 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 31.9 bits (69), Expect = 0.51 Identities = 19/68 (27%), Positives = 35/68 (51%) Frame = +3 Query: 300 YDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTG 479 YD+ A G P R + G +FV + +EA +D+++ F FG I++ ++ D + Sbjct: 221 YDNPATFYGRGEP-TTRGI-GNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRS 278 Query: 480 FLKGYALV 503 +G+ V Sbjct: 279 GHRGFGFV 286 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV+ + E D ++ F +GEI ++++ D + +G + Sbjct: 93 IFVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHRGIGFI 137 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 31.9 bits (69), Expect = 0.51 Identities = 16/64 (25%), Positives = 29/64 (45%) Frame = +3 Query: 312 APEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKG 491 AP G P+ + ++V N+ + ++ FSE G++ + DR TG +G Sbjct: 227 APRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRG 286 Query: 492 YALV 503 + V Sbjct: 287 FGFV 290 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 31.9 bits (69), Expect = 0.51 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 485 L G+ GT L+V ++ E+DI++QF GEI++I + D+ F+ Sbjct: 210 LGKAGEMGTLESPDDESIKTLYVGGLNSRILEQDIRDQFYAHGEIESIRILADKACAFV 268 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 31.5 bits (68), Expect = 0.68 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +3 Query: 360 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 G LFV ++H + +++ + ++G +K + ++ +G KGY VE Sbjct: 233 GAFLFVGDLHWWTTDAELEAELCKYGAVKEVKFFDEKASGKSKGYCQVE 281 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFVS + ++ ++ FS FG+IK L D T KG+ + Sbjct: 9 LFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFI 53 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 31.5 bits (68), Expect = 0.68 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE*RLINKPLVHVKHW 548 ++V NV+ EE+++ FS+ G I + L D + G KG+ V + + VK + Sbjct: 306 IYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEK-GKSKGFGFVCFSTPEEAIDAVKTF 364 Query: 549 MAQIYSAK 572 Q++ K Sbjct: 365 HGQMFHGK 372 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/45 (28%), Positives = 27/45 (60%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 L++ N+ + E+ ++ +F+EFG+I ++ + D +GYA V Sbjct: 203 LYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENR-LCRGYAFV 246 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 485 L G+ GT L+V ++ E+DI++QF GEI++I + ++ F+ Sbjct: 210 LGKAGEMGTLESPEDQSIRTLYVGGLNSRVLEQDIRDQFYAHGEIESIRILAEKACAFV 268 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ N+ E +++++ F FG++ + + +D+ TG K + + Sbjct: 341 LFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFI 385 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHL 458 LFV + + E ++Q+ FSE+G IK++ + Sbjct: 111 LFVGMLPKNVSETEVQSLFSEYGTIKDLQI 140 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ N+ E +++++ F FG++ + + +D+ TG K + + Sbjct: 332 LFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFI 376 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHL 458 LFV + + E ++Q+ FSE+G IK++ + Sbjct: 102 LFVGMLPKNVSETEVQSLFSEYGTIKDLQI 131 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E + ++N F +FG+I + D+ +G KGY V Sbjct: 9 VFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFV 53 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E + ++N F +FG+I + D+ +G KGY V Sbjct: 9 VFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFV 53 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 1/82 (1%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSE-FGEIKNIHLNLDRRTGFLKGYALVE*RLINKPLVHVKH 545 +FV ++ E + + + F +G +K + LDR TG KGY V N+ + + Sbjct: 156 IFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTE 215 Query: 546 WMAQIYSAKRYQLIGASSRDPL 611 Q S + ++ A++++ L Sbjct: 216 MNGQYCSTRPMRIGPAANKNAL 237 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/40 (22%), Positives = 25/40 (62%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 +FV + ++++++ F +FGE+ ++ + +R GF++ Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQ 301 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 ++V + ++E + N F FGEI ++++ DR T +GY V Sbjct: 15 IYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFV 59 >At5g41690.1 68418.m05067 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GI:7673355 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 620 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +3 Query: 342 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 P SVE +LFV+N+ + + DI + F+ GE+ +I L ++ G GY VE Sbjct: 238 PPNSVEE-VLFVANLSPQTKISDIFDFFNCVGEVVSIRLMVNHE-GKHVGYGFVE 290 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 342 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 485 PQ + ILFV NV ++ ++ F +FG+++ +H + GF+ Sbjct: 204 PQGEILSRILFVRNVDSSIEDCELGVLFKQFGDVRALH-TAGKNRGFI 250 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 5/67 (7%) Frame = +3 Query: 297 RYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNI-----HLN 461 R D+ PE ++ P + EG I FV N+ ++ + + F +FG I+N+ H Sbjct: 144 RSDTKPPEEETRNPQQEFRQEGKI-FVGNLPTWIKKPEFEEFFRQFGPIENVILIKGHHE 202 Query: 462 LDRRTGF 482 +++ GF Sbjct: 203 VEKNAGF 209 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +3 Query: 357 EGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE*RLINKPLVH 536 EG LF+ N+ E ++++ F FG + + + +D+ TG K + + L+ PL+ Sbjct: 346 EGANLFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGKLSFDLV-FPLLK 404 Query: 537 VKH 545 + H Sbjct: 405 LVH 407 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +3 Query: 357 EGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 EG LF+ N+ E ++++ F FG + + + +D+ TG K + V Sbjct: 347 EGANLFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGFV 395 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ + + E ++ FS FGE+ + + ++ TG +G+ V Sbjct: 8 LFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFV 52 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 L+ G GP R +FV + E I+ FG ++ +L DR TG K Sbjct: 363 LSSGSTGGLEGPDR------IFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSK 416 Query: 489 GYA 497 GYA Sbjct: 417 GYA 419 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + EE+ +N F +FG I ++ + D T +G+ + Sbjct: 112 IFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFI 156 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + EE+ +N F +FG I ++ + D T +G+ + Sbjct: 112 IFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFI 156 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + EE+ +N F +FG I ++ + D T +G+ + Sbjct: 112 IFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFI 156 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 360 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDR 470 G L V+N+ + EDI+ FSE GE++ ++ D+ Sbjct: 92 GTRLHVTNLDQGVTNEDIRELFSEIGEVERYAIHYDK 128 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV + + ++ F+ FGE+ + DR TG +G+ V Sbjct: 37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFV 81 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV + + ++ F+ FGE+ + DR TG +G+ V Sbjct: 37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFV 81 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 LF++ + E+ ++ F FGE+ + + +D+ + KGYA +E Sbjct: 284 LFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLE 329 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 372 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 FV + ++ E+D+ + FS+FG + + + DR TG + + V Sbjct: 10 FVRGLDQDTDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFV 53 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 ++V N+ Q + ++N FS+FG I + + DR+TG + +A + Sbjct: 214 VYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFL 258 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ + + +++ F+ FG++ + + +DR TG +G+ V Sbjct: 37 LFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFV 81 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF+ + + +++ F+ FG++ + + +DR TG +G+ V Sbjct: 37 LFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFV 81 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV + + EE + FS++G++ + + +D+ KG+A V Sbjct: 23 LFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYV 67 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + + E+++ F +GEI + +D+ TG KG+ V Sbjct: 165 IFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFV 209 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E E + F +GEI+ + +D+ TG KG+ V Sbjct: 106 IFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFV 150 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E E + F +GEI+ + +D+ TG KG+ V Sbjct: 106 IFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFV 150 >At1g66260.1 68414.m07522 RNA and export factor-binding protein, putative similar to GI:7159943 from [Mus musculus] (RNA 6 (4), 638-650 (2000)) Length = 295 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = +3 Query: 360 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDR 470 G ++++N+ + EDI+ ++E GE+K ++ D+ Sbjct: 106 GTTVYITNLDQGVTNEDIRELYAEIGELKRYAIHYDK 142 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E ++ F FG+I + + LDR +G +G+ V Sbjct: 38 IFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFV 82 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 309 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHL 458 L G+ GT P L+V ++ E+DI + F +GE+++I + Sbjct: 207 LRKAGEMGTLEPPEDESIKTLYVGGLNSRIFEQDIHDHFYAYGEMESIRV 256 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 L+++N+ + EE + FS+FG++ L D R G +G+A +E Sbjct: 19 LYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFR-GESRGFAFIE 63 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV N+ +D++ F +FG++ + ++ + G KGY + Sbjct: 14 IFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFI 58 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Frame = +3 Query: 270 SAAERGNRGRYDSLAPEGDSGTPG------PQRSVEGWILFVSNVHEEAQEEDIQNQFSE 431 S + +RG ++ P T G P LFV N++ ++ ++ F Sbjct: 148 SGMQISDRGAANAFVPRKRPNTAGRVSVEHPNGEHPSRTLFVRNINSSVEDSELSALFEP 207 Query: 432 FGEIKNIHLNLDRRTGFL 485 FGEI++++ R GF+ Sbjct: 208 FGEIRSLYTACKSR-GFV 224 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Frame = +3 Query: 270 SAAERGNRGRYDSLAPEGDSGTPG------PQRSVEGWILFVSNVHEEAQEEDIQNQFSE 431 S + +RG ++ P T G P LFV N++ ++ ++ F Sbjct: 161 SGMQISDRGAANAFVPRKRPNTAGRVSVEHPNGEHPSRTLFVRNINSSVEDSELSALFEP 220 Query: 432 FGEIKNIHLNLDRRTGFL 485 FGEI++++ R GF+ Sbjct: 221 FGEIRSLYTACKSR-GFV 237 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +3 Query: 288 NRGRYDSLAPEGDS-GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 464 +RG S G G G + G ++V N+ + +++ FSE G++ + Sbjct: 178 SRGPRSSFGSSGSGYGGGGGSGAGSGNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIY 237 Query: 465 DRRTGFLKGYALV 503 DR +G KG+ V Sbjct: 238 DRDSGRSKGFGFV 250 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/59 (23%), Positives = 31/59 (52%) Frame = +3 Query: 327 SGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 S +P S L+VS + E+ +++ F +FG + ++++ +D+ KG+A + Sbjct: 65 SSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFL 123 >At1g09890.1 68414.m01113 expressed protein ; expression supported by MPSS Length = 633 Score = 29.1 bits (62), Expect = 3.6 Identities = 23/71 (32%), Positives = 33/71 (46%) Frame = +3 Query: 279 ERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHL 458 E NRG +D + G SGT G ++G V +EE E ++ E K + L Sbjct: 50 EEVNRGYWDLVW--GGSGTAGGFDVIKGSNFEVIVKNEEQIELSFTRKWDPSQEGKAVPL 107 Query: 459 NLDRRTGFLKG 491 N+D+R L G Sbjct: 108 NIDKRFVMLSG 118 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/49 (22%), Positives = 27/49 (55%) Frame = +3 Query: 342 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 488 P+ V + V+N+ + EE+++ FS+ GE+ + + + G+++ Sbjct: 230 PESDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIPATKGYGYVQ 278 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 506 +++ NV E + + + + G + ++H+ D+ T KG+A E Sbjct: 9 VYIGNVDERVSDRVLYDIMIQAGRVIDLHIPRDKETDKPKGFAFAE 54 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LFV N+ E + F E G++ + D TG +GY V Sbjct: 179 LFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFV 223 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 LF ++ E ++ + F+ F + D+RTG KGY V Sbjct: 139 LFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFV 183 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +FV + E + +N F +FG I ++ + D T +G+ + Sbjct: 124 IFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFI 168 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 503 +++ + +A E D++ GE+ + + ++ +G KGYA V Sbjct: 94 VYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFV 138 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 485 LFV N++ ++ ++ F ++G+I+ ++ R GF+ Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHR-GFV 207 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +3 Query: 369 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 485 LFV N++ ++ ++ F ++G+I+ ++ R GF+ Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHR-GFV 207 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,629,213 Number of Sequences: 28952 Number of extensions: 279913 Number of successful extensions: 939 Number of sequences better than 10.0: 143 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 939 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -