BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0234 (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value J03592-1|AAA36750.1| 262|Homo sapiens protein ( Human ADP/ATP t... 58 3e-08 CR457400-1|CAG33681.1| 298|Homo sapiens SLC25A6 protein. 58 3e-08 BC031912-1|AAH31912.1| 298|Homo sapiens solute carrier family 2... 58 3e-08 BC014775-1|AAH14775.1| 298|Homo sapiens solute carrier family 2... 58 3e-08 BC008935-1|AAH08935.1| 298|Homo sapiens solute carrier family 2... 58 3e-08 BC008737-1|AAH08737.1| 298|Homo sapiens solute carrier family 2... 58 3e-08 BC007850-1|AAH07850.1| 298|Homo sapiens solute carrier family 2... 58 3e-08 BC007295-1|AAH07295.1| 298|Homo sapiens solute carrier family 2... 58 3e-08 AY007135-1|AAG01998.1| 298|Homo sapiens protein ( Homo sapiens ... 58 3e-08 AL683870-1|CAI39843.1| 298|Homo sapiens solute carrier family 2... 58 3e-08 AB209822-1|BAD93059.1| 323|Homo sapiens ADP,ATP carrier protein... 58 3e-08 M57424-1|AAA51737.1| 298|Homo sapiens adenine nucleotide transl... 56 9e-08 L78810-1|AAB39266.1| 298|Homo sapiens ANT-2 protein. 56 9e-08 J04982-1|AAA51736.1| 298|Homo sapiens ANT1 protein. 56 9e-08 J03591-1|AAA36749.1| 252|Homo sapiens protein ( Human ADP/ATP t... 56 9e-08 J02966-1|AAA61223.1| 297|Homo sapiens ANT1 protein. 56 9e-08 J02683-1|AAA35579.1| 298|Homo sapiens protein ( Human ADP/ATP c... 56 9e-08 BC068199-1|AAH68199.1| 323|Homo sapiens SLC25A5 protein protein. 56 9e-08 BC063643-1|AAH63643.1| 298|Homo sapiens solute carrier family 2... 56 9e-08 BC061589-1|AAH61589.1| 298|Homo sapiens solute carrier family 2... 56 9e-08 BC056160-1|AAH56160.1| 298|Homo sapiens solute carrier family 2... 56 9e-08 BC008664-1|AAH08664.1| 298|Homo sapiens solute carrier family 2... 56 9e-08 AC004000-1|AAB96347.1| 298|Homo sapiens ADP/ATP carrier protein... 56 9e-08 BC022032-1|AAH22032.1| 315|Homo sapiens solute carrier family 2... 54 4e-07 AY550240-1|AAT42263.1| 315|Homo sapiens sperm flagellar energy ... 54 4e-07 AJ863129-1|CAI05952.1| 315|Homo sapiens ADP/ATP carrier isoform... 54 4e-07 AC093591-1|AAY40974.1| 315|Homo sapiens unknown protein. 54 4e-07 >J03592-1|AAA36750.1| 262|Homo sapiens protein ( Human ADP/ATP translocase mRNA, 3' end, clone pHAT8. ). Length = 262 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 233 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 262 >CR457400-1|CAG33681.1| 298|Homo sapiens SLC25A6 protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC031912-1|AAH31912.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC014775-1|AAH14775.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC008935-1|AAH08935.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC008737-1|AAH08737.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC007850-1|AAH07850.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC007295-1|AAH07295.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >AY007135-1|AAG01998.1| 298|Homo sapiens protein ( Homo sapiens clone CDABP0051 mRNA sequence. ). Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >AL683870-1|CAI39843.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >AB209822-1|BAD93059.1| 323|Homo sapiens ADP,ATP carrier protein, liver isoform T2 variant protein. Length = 323 Score = 58.0 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 95 AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 294 AFFKGAWSNVLRGMGGAFVLVLYDELKKVI 323 >M57424-1|AAA51737.1| 298|Homo sapiens adenine nucleotide translocator-2 protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >L78810-1|AAB39266.1| 298|Homo sapiens ANT-2 protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >J04982-1|AAA51736.1| 298|Homo sapiens ANT1 protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >J03591-1|AAA36749.1| 252|Homo sapiens protein ( Human ADP/ATP translocase mRNA, 3' end, clone pHAT3. ). Length = 252 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 223 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 250 >J02966-1|AAA61223.1| 297|Homo sapiens ANT1 protein. Length = 297 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 268 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 295 >J02683-1|AAA35579.1| 298|Homo sapiens protein ( Human ADP/ATP carrier protein mRNA, complete cds. ). Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC068199-1|AAH68199.1| 323|Homo sapiens SLC25A5 protein protein. Length = 323 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 294 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 321 >BC063643-1|AAH63643.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC061589-1|AAH61589.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC056160-1|AAH56160.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC008664-1|AAH08664.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >AC004000-1|AAB96347.1| 298|Homo sapiens ADP/ATP carrier protein (adenine nucleotide translocator 2) protein. Length = 298 Score = 56.4 bits (130), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 6 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 269 AFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC022032-1|AAH22032.1| 315|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 315 Score = 54.4 bits (125), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 3 SAFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 278 SSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >AY550240-1|AAT42263.1| 315|Homo sapiens sperm flagellar energy carrier protein protein. Length = 315 Score = 54.4 bits (125), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 3 SAFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 278 SSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >AJ863129-1|CAI05952.1| 315|Homo sapiens ADP/ATP carrier isoform 4 protein. Length = 315 Score = 54.4 bits (125), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 3 SAFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 278 SSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >AC093591-1|AAY40974.1| 315|Homo sapiens unknown protein. Length = 315 Score = 54.4 bits (125), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 3 SAFFKGAFSNVLRGTGGAFVLVLYDEIKK 89 S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 278 SSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,364,222 Number of Sequences: 237096 Number of extensions: 1546775 Number of successful extensions: 1644 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1644 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -