BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0231 (789 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.04c |||alkB homolog|Schizosaccharomyces pombe|chr 2|||M... 29 1.0 SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomy... 27 4.0 >SPBC13G1.04c |||alkB homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 28.7 bits (61), Expect = 1.0 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = +2 Query: 581 VTSKTYMQLMKSIMXAEIKDVLQSLMPETLLTLSGPKPQTSGLDGPRRPFFNGN 742 V+S+ MQL+KSIM +I+D PE LS G D R ++NG+ Sbjct: 64 VSSELQMQLLKSIMFTQIQD------PENKTNLSPFYQLPLGNDSIWRRYYNGD 111 >SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1010 Score = 26.6 bits (56), Expect = 4.0 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 611 KSIMXAEIKDVLQSLMPETLLTLSGPKPQTSGLDGPRRPFFNGNLMSSM 757 K+ EI D L +++ L L GPK ++ P + FN + S+ Sbjct: 808 KAFCAVEIVDRLAAMLNYNLQALCGPKCSNLKVEDPTKYHFNAKTLLSI 856 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,286,624 Number of Sequences: 5004 Number of extensions: 68898 Number of successful extensions: 154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 383374054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -