BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0228 (672 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens ... 32 2.1 >AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens cDNA FLJ42813 fis, clone BRCAN2012355. ). Length = 180 Score = 31.9 bits (69), Expect = 2.1 Identities = 16/76 (21%), Positives = 35/76 (46%) Frame = +3 Query: 309 FMCVYSH*NIL*II*VLNFQRSHFCFLSNQYIQIFFWLCTHSQLFLCLVTIKKNIRIELS 488 +MC + H + I V + H C N Y+ I+ ++ T Q+++ + T+ + Sbjct: 86 YMCAHIHMCVYTYIYVYIYTHIHICVHINMYVSIYVYIYTCIQIYIYMYTLYVCTYTYMC 145 Query: 489 NSHKVLLILNIIWKCL 536 + + +II+ C+ Sbjct: 146 TYIHICIHTSIIYVCV 161 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,022,602 Number of Sequences: 237096 Number of extensions: 1749249 Number of successful extensions: 6865 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6858 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7647512560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -