BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0224 (620 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0917 - 22574472-22574558,22574756-22574821,22574848-225748... 30 1.7 04_04_1158 - 31342934-31343272,31343508-31343658,31343745-313439... 28 6.9 >07_03_0917 - 22574472-22574558,22574756-22574821,22574848-22574886, 22574978-22575026,22575492-22575559,22575650-22575695, 22575773-22575866,22575956-22576018,22576436-22576558, 22577143-22577176,22577489-22577551,22577678-22577785, 22577914-22577976,22578322-22578378 Length = 319 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -1 Query: 164 VLWYRPIHDLTSIIVSSKFPTLYKTLVFIFHLL 66 VLWYRP+++ + KF + LV++FH+L Sbjct: 191 VLWYRPLYNAMRTDSALKFGLFF--LVYLFHIL 221 >04_04_1158 - 31342934-31343272,31343508-31343658,31343745-31343976, 31344173-31344284,31344572-31344690,31344772-31344936, 31345049-31345247,31345351-31345733,31345838-31345902, 31346003-31346047,31346402-31346467,31346707-31346778, 31346907-31346981,31347086-31347157,31347255-31347326, 31347954-31348022,31348109-31348180,31348280-31348351, 31348756-31348827,31349295-31349366,31349528-31349711, 31350082-31350220 Length = 948 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -2 Query: 310 CKFHXNYAKPNDPRKISLKLLSLSMNDLCFVKPNAM 203 CK N A + + SLKLL LS N++ P AM Sbjct: 280 CKISDNLASIDFSKFASLKLLDLSFNNITGQVPEAM 315 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,717,797 Number of Sequences: 37544 Number of extensions: 210395 Number of successful extensions: 370 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -