BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0220 (336 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070918-1|AAL48540.1| 437|Drosophila melanogaster RE02644p pro... 27 4.6 AE014296-497|AAF47673.1| 437|Drosophila melanogaster CG1246-PB ... 27 4.6 >AY070918-1|AAL48540.1| 437|Drosophila melanogaster RE02644p protein. Length = 437 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 273 SKKRPTTARTRAVPIFAEDQSGAHRPRAQR 184 S + P R + +PIF + GA RP +Q+ Sbjct: 276 SPQYPEQIRPKPLPIFIPSEQGAQRPNSQQ 305 >AE014296-497|AAF47673.1| 437|Drosophila melanogaster CG1246-PB protein. Length = 437 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 273 SKKRPTTARTRAVPIFAEDQSGAHRPRAQR 184 S + P R + +PIF + GA RP +Q+ Sbjct: 276 SPQYPEQIRPKPLPIFIPSEQGAQRPNSQQ 305 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,631,685 Number of Sequences: 53049 Number of extensions: 191278 Number of successful extensions: 618 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 24,988,368 effective HSP length: 75 effective length of database: 21,009,693 effective search space used: 756348948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -