BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0218 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 1.9 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.8 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 599 LAPVCVTRLVFSYAFCPVLSLIYL 528 + P + R++F ++FC +L IYL Sbjct: 1 MKPGELKRVLFFFSFCCILFFIYL 24 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 308 PDTNGSGGADAKHLDVGDASDDEKDMSAADAEGVWSPDI 424 PD NG GGA + D A + A G+ DI Sbjct: 369 PDENGEGGAWVGYEDPDTAGNKASYARAKGLGGIAIVDI 407 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,417 Number of Sequences: 336 Number of extensions: 3348 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -