BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0217 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1044 + 33728623-33728768,33728814-33728993,33729446-337295... 31 0.94 10_08_0904 + 21464762-21467479 29 2.9 01_01_1100 + 8716853-8716860,8717739-8717844,8717931-8718015,871... 29 2.9 04_04_1271 - 32282865-32283167,32283429-32283561,32283683-322839... 28 6.6 01_06_0323 - 28476459-28476915,28477075-28477525,28477623-284779... 28 8.8 >02_05_1044 + 33728623-33728768,33728814-33728993,33729446-33729523, 33729834-33729930,33730206-33730339,33730944-33731025, 33731631-33731717,33731875-33731981,33732674-33732845, 33733018-33733259,33733482-33733563,33733954-33734019, 33734040-33734159,33734935-33735012,33735083-33735178, 33735791-33735897,33736031-33736199,33736402-33736452, 33736567-33736650,33736946-33737040,33737175-33737265, 33737342-33737488,33737614-33737676 Length = 857 Score = 31.1 bits (67), Expect = 0.94 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = -2 Query: 528 PEFEAMH-EVWKNKTLLKGSRVIISEFLTKSRHDVFLEA--RSHFGVKRCWTTDGKIIVL 358 P+ + M E+WKN K + F RHD L + G + T+D +V Sbjct: 356 PDMDKMEFELWKNGLPEKEQKYATGFFTVIKRHDALLPSILAQSDGSNQTKTSDDLFVVP 415 Query: 357 LPDNKRSKIEQMFELQH 307 + +S +E+ EL H Sbjct: 416 YSEEYKSSLEKAAELLH 432 >10_08_0904 + 21464762-21467479 Length = 905 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -3 Query: 689 FHGIPESDATDPATAIVGILTNQMKVAGCTEEDLTACYRLGSNTNKPR-PILVRFLSLRR 513 F+G+PE + AI G + N+ V G E RLG ++P R + Sbjct: 249 FYGMPERNWVSWGAAIAGCVQNEQYVRGL--ELFIEMQRLGLGVSQPSYASAFRSCAAMS 306 Query: 512 CMKCGRTRHS 483 C+ GR H+ Sbjct: 307 CLNTGRQLHA 316 >01_01_1100 + 8716853-8716860,8717739-8717844,8717931-8718015, 8718632-8718715,8718969-8719073,8719621-8719898 Length = 221 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -2 Query: 303 KTKFPSAQK---AQGAPQSLGNLMTNPRRHQNQRQSEKSARG 187 +++F S K +QG+ QSLG P NQ++ ++S+ G Sbjct: 136 RSRFTSGSKNRSSQGSAQSLGQQSAEPAHKHNQKRKDESSLG 177 >04_04_1271 - 32282865-32283167,32283429-32283561,32283683-32283908, 32284058-32284274,32284398-32284558,32285309-32285449, 32285621-32286944 Length = 834 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +2 Query: 284 AEGNLVFRC*SSNICSILLRLLSGRRTIIFPSVVQQ 391 A+GNL +C + +LL ++SG+R P+ +++ Sbjct: 699 AQGNLTLKCDVYSFGVVLLEIISGKRNRTLPTFLRE 734 >01_06_0323 - 28476459-28476915,28477075-28477525,28477623-28477904, 28478089-28478118,28480560-28481433 Length = 697 Score = 27.9 bits (59), Expect = 8.8 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -2 Query: 717 MASRRKGPSVSWNPGVRCHR--PSNSNCGYINQPNEGGWLHRRGL 589 +AS RKG +SW+ RC R ++ CGY G L GL Sbjct: 230 IASLRKGFQMSWDRSDRCSRCELTSGKCGYNQNGKFLGCLCANGL 274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,028,935 Number of Sequences: 37544 Number of extensions: 429553 Number of successful extensions: 1050 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1050 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -